(data stored in ACNUC7421 zone)

EMBL: CP000271.PE537

CP000271.PE537       Location/Qualifiers
FT   CDS_pept        complement(639374..640258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2486"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33505"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY4"
FT                   /protein_id="ABE33505.1"
FT                   /translation="MKEWTLSEQNELATILEKDGDTVLNAWVAGQLSGGIRQGVISEAE
FT                   LRESARSFLAVFARAVKTNYNAQLAGETWDSVRTHLVSLSRERVIQGFSPVETAMFVFS
FT                   LKEPLFEALRKSLGKNPEAFGDALWKLTQTLDSLGLITIEAYQASRQQIIERQQQELLD
FT                   LTTPVVRLWDSVVALPLIGTLDSERTQVVMESLLDSIVENEAAIAIIDITGVPTVDTLV
FT                   AQHLLKTVAAARLMGAECIISGIRPQIAQTIVHLGVDLGDVVTKATLAEALKIALRRVG
FT                   MTVTKIATAKQGD"
     atgaaggagt ggactttgag cgaacaaaac gagttggcaa ccatcctcga aaaagacggg        60
     gataccgttt taaatgcgtg ggtggctgga caactgtccg gcggtatccg ccagggtgtt       120
     atttcagaag ctgagttgcg cgagtccgcg cgctcgtttc tggccgtctt tgcacgcgcg       180
     gtcaaaacaa actacaacgc ccagcttgcc ggcgaaacat gggattcggt tcgcacccac       240
     ctcgtgtcac tgtccagaga gcgggtcatt cagggttttt ccccggtcga aacggccatg       300
     ttcgtgtttt cgctgaaaga gcctctgttc gaagcgctgc gtaaatcgct cggcaagaat       360
     cccgaggcat tcggcgacgc attgtggaaa ctcacgcaaa cgctcgacag cctgggtctg       420
     atcacgatcg aagcgtatca ggcgagccgc cagcagatca tcgagcggca acaacaggag       480
     ttgctggatc tcaccacgcc ggttgtccgg ttgtgggact ccgtggtcgc attgccgctg       540
     atcggtacgc tcgacagcga gcgcacccag gtcgtcatgg aaagcctgct cgattccatt       600
     gtcgagaacg aggcggccat tgcgatcatc gatattaccg gcgtgccgac cgtcgatacg       660
     ctggtcgccc agcatctgct gaagaccgtc gcggcagcac ggctgatggg cgcggaatgc       720
     atcattagcg gcattcgccc ccagatcgcg cagaccatcg tgcacctcgg tgtcgacctg       780
     ggtgacgtgg tgacaaaggc cacgctggcc gaagcactga aaatcgcctt gcggcgcgtc       840
     ggcatgacgg taacgaagat cgctaccgcg aagcagggcg actga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page