(data stored in ACNUC7421 zone)

EMBL: CP000271.PE538

CP000271.PE538       Location/Qualifiers
FT   CDS_pept        640460..640816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33506"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY3"
FT                   /protein_id="ABE33506.1"
FT                   /translation="MGIHCSAIAQGLPSAVASEDRISAAIDPWLTIAASEMPPVILLFR
FT                   PAFLEIGCAVTRIHLNRPWKGLHVPPLIWAAEVNFDPGSVALVLASDVYNEADYVRDYD
FT                   DYLALMKELTQKQV"
     atgggtattc actgctccgc catagcgcag ggcttgccat cggcggtagc ttccgaagac        60
     cggatttctg ccgcgataga tccctggttg acgattgccg ccagcgagat gccgccagtc       120
     atattgctat tccgcccggc tttcctcgaa atcggctgtg ccgtcacgcg tatccatttg       180
     aatcgaccgt ggaagggctt gcatgtgccc ccgttgatct gggcagcaga ggtcaacttc       240
     gacccgggct cggtcgcgct ggttctcgcg tcggatgtct acaacgaagc ggattatgtc       300
     cgggactacg atgactatct ggcgttgatg aaagagctga cgcaaaagca ggtttga          357
//

If you have problems or comments...

PBIL Back to PBIL home page