(data stored in ACNUC7421 zone)

EMBL: CP000271.PE539

CP000271.PE539       Location/Qualifiers
FT   CDS_pept        640821..642395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33507"
FT                   /db_xref="GOA:Q13QY2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY2"
FT                   /protein_id="ABE33507.1"
FT                   /translation="MDRVVRLTSEPKSETHRQRVGMVAAALFVVLVIVVLRLAVIGGYP
FT                   STDEGIYEYYALIIHDRLSQDLRLPNDGMLMLYPLLTSFVYSLKVNPIFALRLIDVVPD
FT                   ALAAVLMLRISVRLSGSLIASALITALFFLLLNHPTFIQYGFKNSFFIALCPLLYAVIL
FT                   FLSGQQAGPGRFFAMGVLVALGVLLRETLLLFAVLGAVSIFVERGTRALKYFVAGGLAT
FT                   GSLVLIVAIGLRGPGGVSSLISGYVDTGVGYGAFGDLRWKLFKSSGQLAAQAAVAGLVM
FT                   SLAATVCIVVASIRGRTKEYFKPFVFWAAAALIPLVEPLSKLGLPYHFSWSLIGLCSIT
FT                   SLGWRACRFSGRVQKLIGSGVCIGVSLLLVWSQLQFQRGLFWGLTYPAFKETHGKYWAE
FT                   ESIQRSNYLLMADQIKRIAPANATLSSSAAMLILYPLTGLRPPCYGVSNLTVTAVTLHF
FT                   NVEAMRRAIESCPADVVVVTRRDLPGSSTVVQAIRELPQYRRVGTVDVSTARDYGTSSA
FT                   ELFVLQR"
     atggaccgcg tcgtaagatt gacatcagag ccaaagtcgg agacgcaccg ccaacgcgta        60
     ggcatggtcg ccgccgcttt gttcgtcgtg ctcgttattg tcgtgttgcg gctggcggta       120
     atcggaggct atccatctac ggacgaaggc atctacgaat actatgcgct gattatccat       180
     gaccggttat cgcaagacct gcgtcttccg aatgacggca tgttgatgct ctacccgctg       240
     ctaacgtctt tcgtctattc gctcaaggtc aatccaattt ttgcgttgcg actgattgat       300
     gtggttccag acgcgttggc cgctgtcctg atgctgcgaa tatcggtccg tctgagtgga       360
     agcctgatag cgagcgcgct cattaccgcg ctgttttttc tgctgctgaa ccatccgaca       420
     tttattcaat atgggttcaa gaacagcttc ttcatagcac tctgtccgtt gttgtacgcg       480
     gtgattctgt tcctgtccgg ccagcaggcc ggtccgggca gattctttgc aatgggagta       540
     ctcgttgcgc tcggcgtact cctgcgagaa acgctacttc tgttcgctgt gttgggggcg       600
     gtctccatct tcgtggagcg gggtactcgc gcactgaagt actttgttgc aggcggattg       660
     gcaactgggt ctctcgtact tatcgtggca atcggcctgc gaggccccgg cggcgtatcc       720
     agcctgatat ccggctatgt tgacaccggc gtcggatatg gggcgtttgg tgatttgcga       780
     tggaagctct tcaagtcgag cgggcaactc gccgcgcagg cagcggtcgc agggttggtc       840
     atgagtctgg cggcaacggt atgcatcgtc gtcgcgtcga ttcgcggaag aacgaaggaa       900
     tatttcaaac ctttcgtttt ttgggcggct gccgcgttga ttccgctcgt tgaaccgctc       960
     tcgaaactgg gtctgcctta ccatttctca tggtcgctga tcggtctgtg cagtatcacg      1020
     agtctgggtt ggcgcgcctg ccgtttcagt ggccgggtgc aaaagctcat tggtagcggc      1080
     gtgtgcattg gcgtctcttt gctgctcgta tggtcccagc ttcaattcca acgcggcctt      1140
     ttttggggac tcacttatcc cgctttcaag gagacgcacg ggaaatattg ggccgaggag      1200
     tcgattcagc gtagcaatta tctgctcatg gctgatcaga tcaaacgcat tgctcctgct      1260
     aacgccacgc tgagttcgag tgccgcaatg ctgatactgt atccgctcac gggtcttcgc      1320
     ccgccgtgtt acggcgtcag taatctgacc gtcacggctg tcacgctgca tttcaacgtc      1380
     gaagccatga gacgggccat tgaaagttgt ccagctgacg tggtcgtagt gacccggaga      1440
     gacttgcccg gtagctcgac cgtcgtgcag gcgatccgcg aactgccgca gtatcgccgc      1500
     gtcggcacgg ttgatgtttc gaccgcccga gattacggaa cctccagcgc cgagttgttc      1560
     gtgctccagc gttga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page