(data stored in ACNUC7421 zone)

EMBL: CP000271.PE54

CP000271.PE54        Location/Qualifiers
FT   CDS_pept        59712..59990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2973"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2973"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33022"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB7"
FT                   /protein_id="ABE33022.1"
FT                   /translation="MRHVTIFVHDASLAWPIATSCRTVTTRFVHSVRVKRPVGQASSPL
FT                   LTYQINPSEISERGDLSHVILMLDNLTSHCLLPERHVRSLEQEASYS"
     ttgaggcatg tgacgatctt cgttcatgac gcttctcttg cgtggccgat tgccacatct        60
     tgtcgaaccg tcacgactcg gtttgtccat tcagtgcgcg tcaaaaggcc cgtcggacaa       120
     gcctcatcgc cgttattgac gtatcagatt aatccgtcgg aaatttcaga aagaggcgat       180
     ttgtcccatg taattttgat gttggacaac ttaacatcac attgtcttct gcctgaaaga       240
     cacgtcagga gcttggaaca ggaagcctcg tattcctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page