(data stored in ACNUC7421 zone)

EMBL: CP000271.PE540

CP000271.PE540       Location/Qualifiers
FT   CDS_pept        642948..644918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33508"
FT                   /db_xref="InterPro:IPR021884"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY1"
FT                   /protein_id="ABE33508.1"
FT                   /translation="MNHIPRFAKRLSWLSAVFLIVLAAGCGGSSDNVSNGGDQPASAPG
FT                   GTQDTTRPAVSAAVPAPGATGVGVTTKIAVTFSKDMNPATISASSFTVSGPGATPIAGT
FT                   VNYTVGSRAAVFTSTNASLPAGTVLTATITTAAKDVSGNALQNNFVWTFTTAAAPDVTP
FT                   PTVSLSVPAAGATNAALNTHIAATFSEDMDPSTITATSFTLTGPGGAPVAGTVSYAAGA
FT                   KSAIFTPTSPAVLSAATAYTATITTAAKDLSGNALVSKFAWTFTTGTTTDTTPPSIVSA
FT                   NPANGVTGVCTNKSVNVTFSEAMDPSTLTGATFTVAASSTPATLLSGTVAYDVPSKVAT
FT                   FTTTSPLAANTSYTATVTTGVKDLAGNALALASVTTFTTNSSLCTTAPALGGAQPFGSF
FT                   GGNASVTNAGLNSVIHGDLGVNAASTKITGLTDSSGTHFTTTTSNNGLVTGLVYTLTAP
FT                   ANSVPGLAVTQASLDATTAFNSLSPASLPGGINVASLAQCPSCGGAGGGADELAGRTLP
FT                   PGVYLSSTGTFDIGGVGRTTANLTLDAGGDANAVWVFQTAAGTGTLNVGLTGPATPAVP
FT                   IQVLLVNGAQAKNVFWYVPAGAVIGTGSTMTGTMLANASITLSTVGGTPPTAVITTLNG
FT                   RAIALTAAVTMVNTVINLPSQ"
     atgaatcaca taccgcgttt cgcaaaacgg ctgagctggt tgtcggcagt gttcctcatc        60
     gtattggcgg cagggtgcgg tggttcttcg gacaatgttt ccaacggcgg tgatcaaccc       120
     gcttccgcgc cgggtggaac tcaggacacg acccgtcccg ctgtcagcgc cgccgtgccc       180
     gcgccgggcg ccacgggtgt cggcgtaacg acgaagatcg ccgtcacttt cagtaaggac       240
     atgaacccgg cgacgatttc cgcgtcgagc ttcaccgtca gcggtccggg cgccaccccg       300
     attgccggta cggtgaacta taccgtcggc tcaagagccg ctgtattcac gtccacgaat       360
     gcttcgctgc cggcaggcac ggttctcacg gcaacgataa ccactgcggc gaaggacgtt       420
     tcgggtaacg cgctgcagaa caatttcgtc tggacgttca ccacggcggc cgctccggat       480
     gtaactccgc cgacggtatc gctgagcgtg cctgccgcgg gcgccaccaa cgctgccctg       540
     aacacgcaca ttgctgcgac cttcagcgaa gacatggatc cgtcgacgat cacggcgacc       600
     agcttcacac tgaccggccc cggcggcgcg ccagtcgcgg gtacggtgtc ctacgcggcg       660
     ggtgcaaaaa gtgccatctt cacaccgacc tcgcctgcgg tcctgagtgc ggcaaccgcc       720
     tacactgcaa cgattaccac cgctgccaaa gatctttccg gcaacgcgct agtcagcaag       780
     tttgcgtgga cgttcaccac gggaaccacc acggacacga cgcctccgtc gatcgtatcg       840
     gccaacccgg ccaatggcgt gaccggtgtt tgcaccaaca agtcggtcaa cgtgaccttc       900
     agcgaggcga tggacccgtc gacccttacc ggcgcgacgt tcacggtcgc ggcgtcgagc       960
     acgcccgcca cactgttgtc aggtaccgtt gcctatgatg tgccgagcaa ggtggcaacc      1020
     ttcaccacaa ccagcccgct cgcggctaac acgagctaca ccgctacggt cacgaccggg      1080
     gtgaaggatc ttgcgggcaa tgccctggcg ttggcttcgg tgacgacatt cacgacgaat      1140
     tcgtcgctgt gcacgacggc accggcattg ggtggcgccc agccctttgg ttcgttcggt      1200
     ggtaatgcat cggtcaccaa cgccggattg aattcggtca ttcacggcga cctgggtgtg      1260
     aatgccgctt caacgaagat aacggggctg accgattcga gcggcaccca cttcacgact      1320
     accaccagca ataacggact ggtaacgggt ctggtgtaca ccctcactgc gcctgccaat      1380
     tcggtcccgg gacttgcggt cactcaggca agccttgacg ccacgaccgc gttcaattcg      1440
     ctgtcgccgg cttcgttgcc gggtggtatc aacgttgcga gcctggccca gtgtccgagc      1500
     tgtggcggcg ctggaggggg ggcggacgaa ctcgcaggcc gtacgcttcc gccgggcgtc      1560
     tatctgtcca gcacgggtac gttcgatatc ggcggtgttg gccgcacgac agccaatctg      1620
     acgctcgacg cgggtggcga tgccaatgca gtgtgggtct tccagacggc agccggtaca      1680
     ggtacattga atgtcggctt gaccggaccc gcgacacccg cggtgccgat ccaggtgttg      1740
     ctcgtcaatg gcgcccaggc gaagaacgtg ttctggtacg tcccggccgg tgctgttatc      1800
     ggcacgggat ccacgatgac cggaacgatg ctggccaatg cgtcgatcac tctgtcgacg      1860
     gtaggcggaa cacctccgac tgccgttatc acgacgctca acggtcgcgc aatcgcattg      1920
     accgccgcgg tgacgatggt caatacggtt atcaatctgc cttcacagta g               1971
//

If you have problems or comments...

PBIL Back to PBIL home page