(data stored in ACNUC7421 zone)

EMBL: CP000271.PE543

CP000271.PE543       Location/Qualifiers
FT   CDS_pept        647706..648239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33511"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX8"
FT                   /protein_id="ABE33511.1"
FT                   /translation="MQATKENQTDTRTGTTDALAFLEADHRAVEKLFTAFKKADDDLEA
FT                   KAALAQRACEELTIHAMLEEELLYPAAQEALPDSDKVDVEEAYVEHYLVKSLIAKFETL
FT                   KAGDKGFDATFKVMSEMVDHHVEEEEQELFPELRKSKCDLRTLGEKLAKRKAELQAKLD
FT                   AVGSRAVGDKTATL"
     atgcaagcca cgaaagagaa ccagacggac acccgcaccg gcacaaccga cgcgttggcc        60
     tttctggagg cggaccatcg agcagttgaa aagttgttca ccgctttcaa gaaagcggac       120
     gacgacctcg aagcgaaggc ggcgctggca cagcgtgcct gcgaagagct aaccattcat       180
     gcgatgctgg aggaggaact gctttatccg gctgcgcagg aagcgttgcc tgacagcgat       240
     aaggtggacg tcgaagaagc ctacgtcgag cactacctcg tcaaatcgct gattgcgaaa       300
     ttcgaaacgc tgaaagcggg cgacaaaggt ttcgacgcaa ccttcaaggt aatgagtgag       360
     atggtggacc atcacgtgga ggaagaagaa caggaactct tcccggaact gcgcaagtcg       420
     aaatgcgatc tccgcacgct cggtgaaaag ctggcaaaac gcaaggcgga actgcaagcc       480
     aagctcgatg ccgtgggcag cagagcggtg ggcgacaaga ccgcgacgct ttga             534
//

If you have problems or comments...

PBIL Back to PBIL home page