(data stored in ACNUC7421 zone)

EMBL: CP000271.PE547

CP000271.PE547       Location/Qualifiers
FT   CDS_pept        complement(650418..651206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2476"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33515"
FT                   /db_xref="GOA:Q13QX4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX4"
FT                   /protein_id="ABE33515.1"
FT                   /translation="MQHYGLANVWESGDIVTRCILGTLLIMSVLSWTVILVKLWTIVRI
FT                   RRVTRQAEAQFWRADRFEDGLKSLGAEASKSVRDNPLLALALAGEEAAAHHRQTQSHLH
FT                   DRIDVSDWITRRLQDTMDDAIARMQSGLAVLASIGSTAPFVGLFGTVWGIYHALILIGE
FT                   TGQTSIDHVAGPVGESLIMTAFGLFVAIPAVLGYNGLTRANKSVVTRLKRFAHGLHAYF
FT                   VTGSQLPSSTGPDMRIVPRAVPAANGKANDATNDGALKWQ"
     atgcaacact acggcctcgc gaatgtctgg gaaagcggcg atatcgtcac gcgctgcatt        60
     ctgggcacgt tgctgatcat gtcggttctc tcgtggacgg tgattctcgt caagctatgg       120
     accattgtgc ggatcaggcg cgtaacccgc caggccgaag cgcaattctg gcgagccgac       180
     cgtttcgagg acggcttgaa gagcctcggc gccgaagcat cgaagtcggt ccgcgacaac       240
     ccgcttctcg cgctcgctct ggccggcgag gaagccgcgg cccatcatcg gcaaacgcag       300
     tcgcatctgc atgaccgcat cgacgtatcc gactggatta cgcgccgcct gcaggacacg       360
     atggacgacg ccatcgcacg catgcaaagc ggactcgcgg tgttggcatc gatcggcagc       420
     accgcgccct tcgtggggct cttcggcacc gtgtggggca tttaccacgc gctcatcctg       480
     atcggcgaga cgggacagac ctcgatcgat cacgtcgccg gaccggtcgg cgagtcgctg       540
     atcatgacgg ccttcggcct ctttgtagcg atacccgcgg tgctgggata caacgggctg       600
     acccgcgcca acaagtcggt cgtgacgaga ctcaagcgtt tcgcgcatgg actgcatgcg       660
     tatttcgtga ccggctcgca attgccgtcg agtaccggtc ccgacatgcg catcgtgccg       720
     cgcgccgttc ctgcggcaaa tggcaaagcc aatgacgcca cgaacgacgg agcgctcaaa       780
     tggcaatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page