(data stored in ACNUC7421 zone)

EMBL: CP000271.PE548

CP000271.PE548       Location/Qualifiers
FT   CDS_pept        complement(651234..651926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2475"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33516"
FT                   /db_xref="GOA:Q13QX3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX3"
FT                   /protein_id="ABE33516.1"
FT                   /translation="MALGAVVAAHVGLLAWVSATLDRTVERTVEAPAIVAMLLRNEPET
FT                   AAPITPVARAVPAPAAVVAAPQAAQPPARSKLAPPRLKAPRSSVAPAPGAPGAPDVPAT
FT                   PSPSRDAARSPEPTAPAVAAAPSPAAPATNAPATPKSVAHVDCDIPKPDYPDISKRRSE
FT                   SGTAIVRFVVGLSGHIETAQLQKSSGYPRLDDAALSAVHAGACQPYRENGEAVRAAYSE
FT                   SFVFGLTE"
     gtggcgctgg gcgccgtggt cgccgctcat gtgggtttgc tcgcgtgggt gtcggcaacg        60
     ctggacagga cggtggagcg aacggtcgaa gcaccggcca tcgttgcgat gttgttgagg       120
     aatgagccgg agacggctgc acccatcaca cctgtagcgc gtgccgtgcc cgcgccggcc       180
     gccgtggttg cagcgccgca agccgcgcag cctccggcac gcagcaaact cgcgccgcct       240
     cgtctcaagg cgccgcgcag cagcgtagcg cctgcgccgg gtgcgccagg tgcgccggat       300
     gtacctgcca cgccgtcgcc gtccagagac gctgcacgct caccggagcc cactgccccg       360
     gccgttgctg ctgcgccttc gcccgcagca ccggcaacga atgcaccggc tacaccaaag       420
     agcgtagcgc acgtcgattg cgatattccc aagccggatt atcccgacat atcgaagcgc       480
     cgcagtgaga gcggcacggc gatcgtgcgc ttcgtagtag gcctgagcgg tcatatcgaa       540
     accgcgcaac tgcaaaaaag cagcggctat ccccggctcg acgacgcagc gctctctgcc       600
     gtgcacgccg gggcctgcca gccatacagg gaaaacggcg aagcggtacg cgccgcctat       660
     tcggaatcgt tcgtcttcgg cttgaccgag taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page