(data stored in ACNUC7421 zone)

EMBL: CP000271.PE549

CP000271.PE549       Location/Qualifiers
FT   CDS_pept        652196..653290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2474"
FT                   /product="WD-40 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33517"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX2"
FT                   /protein_id="ABE33517.1"
FT                   /translation="MLETRFRNTTPTRSLAFAVATLATAATAFALAASTAYAAAPMAYV
FT                   TSEKAGVGVIDLDQMTLTKTFPVGADGPRGLSLNTDGTRLLVANKNTGDLAVIDTASGQ
FT                   VVQRVKIGKNPEYVRVHNGFAYVTYEPGEDGGPPAANAKPGADDDDANKPPAQIAIVDM
FT                   KTWRVIRSVTSGHETEGIEFSRDGNMMLVTNEGDDTVSVYHVRTGAPVRTVKLVAGGRP
FT                   RGIRLSPDGKDYVVTLESLSKFVVIDARTYQVTKTVDTKLGPYGVAFGPDGKRLFVAAA
FT                   RDRTVQVFDGHSYEHLADVPVGQRCWHFSFTPDGAKLLVACGRSDAVYVLDAQSYQPIK
FT                   QIGELPLAWGIVTYPHSDGSIESH"
     atgctggaga cacggttccg caacaccaca ccaacacgtt ccctcgcttt cgctgtcgcc        60
     acgttagcca ctgccgccac ggcgttcgcg ctcgccgcga gcacggcata cgccgccgcc       120
     ccaatggcct acgtgaccag cgagaaggcc ggcgtcggcg tgatcgatct ggatcagatg       180
     acgctgacaa agacgtttcc ggtcggcgcc gacggcccac gcggcctgag tctgaatacc       240
     gacggcacac ggcttctcgt ggccaacaag aacaccggcg acctggcggt gatcgacacg       300
     gcttcgggtc aggtcgtgca gcgtgtgaag atcggcaaga accccgaata tgtgcgcgtg       360
     cacaatggct tcgcatacgt aacctacgag cccggcgaag acggtggccc acctgccgcc       420
     aacgcaaagc cgggtgccga cgacgatgac gccaacaagc cgcccgcgca gatcgcgatc       480
     gtcgatatga aaacctggcg cgtgatccgt tcagtgacga gcggccacga aaccgaaggc       540
     atcgaattct cacgcgacgg caacatgatg ctcgtcacca acgagggcga cgacacggtg       600
     tccgtttatc acgtccgcac gggcgcgccg gtgagaaccg tgaagctcgt cgcaggtggc       660
     cgtccgcgcg gcatccgcct gtctccggat ggcaaggatt atgtggtcac gctcgaatcg       720
     ctaagcaagt tcgtggtgat cgacgcgcgt acgtaccagg ttacgaagac tgtcgatacg       780
     aagctcgggc cttacggggt agcgttcggg ccggatggca agcggctttt tgtcgccgcg       840
     gcgcgcgaca ggaccgtgca ggttttcgac ggccacagct acgagcatct cgccgacgtg       900
     ccggtggggc agcgttgctg gcacttcagc ttcacgccgg atggcgcgaa gctgctggtg       960
     gcgtgcgggc gctccgacgc ggtgtatgtg ctcgacgcgc agagctatca gccgatcaag      1020
     cagatcggcg aactgccgct ggcctggggc atcgtcactt atccgcatag cgacggctcg      1080
     atcgaatcgc attga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page