(data stored in SCRATCH zone)

EMBL: CP000271.PE55

CP000271.PE55        Location/Qualifiers
FT   CDS_pept        60092..60652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2972"
FT                   /product="putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33023"
FT                   /db_xref="GOA:Q13SB6"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB6"
FT                   /protein_id="ABE33023.1"
FT                   /translation="MKLSLPAIAIAASSLFGLVPLGAHAADGTISITGTVTDSTCSING
FT                   NANGTPADKAITLATVPAGSLASAGAVAGTSNPTDLQLSLTGCTGTATKAIARFENGPT
FT                   VDQTNGYLSNTAGTAQNVEVRLLNAQMQPINVTTGANNDITTNAATISGGAATLQYFAQ
FT                   YYATGVATAGTVSSSVQYSMEYQ"
     atgaagttat ccctccccgc aatcgcgatc gcagctagca gtctgttcgg tctcgtaccc        60
     cttggcgccc atgcggcgga cggcacgatc tcgatcaccg gcaccgtaac ggatagcacg       120
     tgttcgatca acggcaatgc gaacggtacc ccggccgaca aggcgatcac gctggcgacg       180
     gttccggccg gttcgcttgc gtcggcaggc gcggtggccg gcacgtccaa cccgaccgat       240
     ctgcaactga gcctgaccgg ctgcactggc acggccacga aggcgattgc gcgcttcgag       300
     aacggcccga cggtcgacca gacgaatggc tatctgtcga acacggcggg taccgcgcaa       360
     aacgtggaag ttcgtctgct caacgcgcag atgcagccga tcaacgtcac gacgggcgcg       420
     aacaacgata taacgacgaa cgcggcaacc atctcgggcg gcgcggcgac gctgcagtat       480
     ttcgcacagt attacgcaac gggcgttgcg actgccggca cggttagctc gtcggttcaa       540
     tactcgatgg aatatcagta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page