(data stored in ACNUC7421 zone)

EMBL: CP000271.PE550

CP000271.PE550       Location/Qualifiers
FT   CDS_pept        complement(653377..655743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2473"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33518"
FT                   /db_xref="GOA:Q13QX1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX1"
FT                   /protein_id="ABE33518.1"
FT                   /translation="MNMPLSAHRASRLPDLPRLRRRAGLTLCFGSALASLSVPVWAQAE
FT                   TATPAAAASSAAPAGASPDADTVKLAPIVVVGTTPLLGIGTPLSQVPANVQTVHAQDLE
FT                   QQHRSTLTDYFAKNLPSVDIADAQGNPYQVNLNYRGFTASPLLGTPQGLSVFVDGVRVN
FT                   EPFGDVVNWDLLPQQAIDTIQLIPGSNPTYGLNTLGGALAITTKNGKTSPGGEAEVQVG
FT                   SWGRKTAQIEQGGTIGQNLDYYVTGSMANDNGWAEQNASRVRQAFGKLRYTDADTTLSF
FT                   SAGGADNDLHGTQTIPRSFLGNPKQPYTYPDQNLNTAAYATLSGDHYFNDHVELSGNVY
FT                   YRHFRNDNVSSNTNSDFGSVDDDGNVDTTQATNEKSIVSTDSYGASLQLTLLGKLGGME
FT                   NQFVAGVSADIANSRYTQSSQDAVFTASRATIGIGDFEQETAAKTHNGNYGIYLQDTLS
FT                   LTKQWTLTLAGRYNWADATIGDSSGTQPQLDGHHTFSRFNPAVGINWNPTSAFTAYATY
FT                   NEGMRSPTAIELACADPSAPCSLPNDFVSDPSLQPVISKTFEIGARGRIGQATTWSAAA
FT                   YSTTLDNDIEFISTNGATSNQGFFQNVGRTRRQGVELSGHSQFGPLAVTASYSYVDATY
FT                   RSSWTESSPSNSSADQNGNITVKPGDHIPSIPANTVKLQLDYAATAKWNVGTNLTWRGS
FT                   VYAQGDENNQDVNGKIAGYLLIDLDTSYQVTKQLQVFASVTNLLDKRYASFGALGENFF
FT                   NGANHTFDGANPINEQFVGPGAPRGFWVGLRYAWK"
     atgaacatgc cgctcagcgc gcaccgcgca tcccgcttac cggacttgcc acgtttgcgc        60
     cggcgtgccg gtctcacgct ctgcttcggc agcgcgctcg caagcctgtc ggtcccggtg       120
     tgggcccagg ccgaaaccgc cacgccggca gcggcggctt cgtcggccgc gccggccggt       180
     gcgagtccgg acgccgatac ggtgaagctc gcgccgatcg tcgtggtcgg caccacgccg       240
     cttctcggca tcggcacacc gctctctcag gtgcccgcca atgtgcagac cgttcacgcg       300
     caggacctgg aacagcagca ccgcagcacg ctcaccgact acttcgcgaa gaacctgccg       360
     agcgtcgata tcgccgatgc gcagggcaat ccgtatcagg tcaacctcaa ctatcgcggc       420
     ttcacggcgt cgcctctgct cgggacgccg caaggcctct cggtgttcgt ggacggcgtg       480
     cgcgtgaacg agccgttcgg cgacgtggtg aactgggacc tgctgccgca acaggcgatc       540
     gacacgatcc agctgattcc cggttcgaat ccgacctacg ggctcaatac gctgggcggc       600
     gcgctcgcga tcacgacgaa aaacggcaag acgagccccg gcggcgaggc cgaagtgcaa       660
     gtgggctcgt ggggccgcaa gaccgcccag atcgaacagg gcggcaccat tggtcagaat       720
     ctggattact acgtgaccgg cagcatggcg aacgacaacg gctgggcgga gcagaatgcc       780
     agccgcgtgc ggcaggcgtt cggcaagctg cgctataccg acgcggatac gacgctgtcg       840
     ttctcggcgg gcggcgcgga caacgacctg cacggcacgc agaccattcc gcgatctttc       900
     ctcggcaatc cgaagcagcc ttatacctat cccgaccaga atctgaacac cgccgcgtac       960
     gcgacgctct cgggcgacca ttacttcaac gaccatgtag aactgagcgg caacgtttat      1020
     taccggcact tccgcaacga caatgtgagc agcaacacca actcggactt cggctcggtg      1080
     gacgacgacg gcaacgtcga tacgacccag gccaccaacg aaaaatcgat cgtctcgacc      1140
     gacagctatg gcgccagcct gcaactcacg ctgctcggca agctcggagg aatggagaac      1200
     cagttcgtcg ctggtgtgtc cgcggatatt gccaactccc ggtacaccca atcttcccag      1260
     gacgcggtgt tcaccgcttc acgcgcgacg atcggcattg gcgatttcga gcaggaaacc      1320
     gcggcgaaaa cgcataacgg aaactacggc atctatctgc aggacacttt gtcgctcacg      1380
     aagcaatgga cgctgacgct ggccggacgc tacaactggg cggacgccac gatcggcgat      1440
     tcgagcggca cgcagccgca actggacggc caccatacgt tttcccgctt caatccggcg      1500
     gtcggcatca actggaaccc gacctccgcg ttcacggctt atgccaccta caacgaaggc      1560
     atgcgttcgc cgaccgccat cgaactggcc tgtgcggatc cgtccgcgcc gtgctcgctg      1620
     ccgaacgact tcgtgtcgga cccgtcgctt cagccggtga tctcgaagac ctttgaaatc      1680
     ggcgcacgcg gacgcatcgg ccaggcaacg acctggagcg ccgccgctta cagcacgacg      1740
     ctcgacaacg acatcgaatt catcagcacg aatggcgcca ccagcaacca gggcttcttt      1800
     cagaacgtcg gccgcacgcg ccggcaaggc gtggagctgt ccggacacag ccagttcggg      1860
     ccgctcgcgg tcacggccag ctacagctat gtcgatgcga cctaccgttc gagctggacc      1920
     gaaagcagcc cgagcaactc cagcgcggat cagaacggca atatcacggt caagccgggc      1980
     gaccatattc ccagcatccc ggccaacacc gtcaaactgc aactcgacta tgcggccacc      2040
     gcgaagtgga acgtcggcac caacctgacc tggcgcggca gcgtctatgc acagggcgac      2100
     gaaaacaacc aggacgtgaa cggcaagatc gccggctatc tgctgatcga tctggatacc      2160
     tcgtaccagg tgaccaaaca gttgcaggtc ttcgcgagcg tcacgaacct gctcgacaag      2220
     cgctacgcga gcttcggcgc gctcggcgag aacttcttca acggcgcgaa ccatacgttc      2280
     gacggcgcca acccgatcaa cgaacagttc gtcgggccgg gcgcgccgcg tggtttctgg      2340
     gtggggttgc gctacgcgtg gaagtag                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page