(data stored in ACNUC7421 zone)

EMBL: CP000271.PE551

CP000271.PE551       Location/Qualifiers
FT   CDS_pept        655948..656958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2472"
FT                   /product="Periplasmic Sensor signal transduction Histidine
FT                   Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33519"
FT                   /db_xref="GOA:Q13QX0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX0"
FT                   /protein_id="ABE33519.1"
FT                   /translation="MASDPSNPSSARPVPPHSTVRRDLAWVLALTVLAAVLSARFDFSE
FT                   HAYRWTRGLERFQLDELPGTLCVLSIGLAWFAWRRYREARRELIRRCALEEQAERLLAE
FT                   NRRLANQALQAQELERRHLARELHDELGQYLNAISLDAARIRDLSSAREPEVHRVSLGL
FT                   IQSASHVYRQIGGMIRRLRPIGLDEFGLPSALEHCVDGWRERLPDASFSLTIEGDFTGL
FT                   SDALTITLYRLVQEGLTNVSKFARTARVEVFMVRAPREARERQDGRLVDEIVVTMADDG
FT                   PGADLDKPRGGLGLIGMRERVEALGGEFHVASRPEGGFLFCARVPAHAGLAEPVN"
     atggcaagcg atccctcgaa cccttcttca gcgcgccccg ttccgccgca ttcgacggtg        60
     cggcgcgacc ttgcatgggt gctcgcgctg acggtgctcg ccgccgtgtt gagcgcgagg       120
     ttcgatttca gcgagcacgc ttaccgctgg acgcgcggcc tcgaacgctt ccagctcgac       180
     gaattgccgg gcacgctgtg cgtgctctcc atcggcctcg cgtggttcgc atggcgccgg       240
     tatcgcgagg cgcgccgcga gctgatccgt cggtgcgcgc tggaagagca ggccgaacgg       300
     ctgctcgccg agaaccggcg cctcgccaat caggcgttgc aggcgcagga actggaacgc       360
     cgccatttag cgcgcgaact gcacgacgaa ctgggccagt acctgaacgc gatctcgctc       420
     gacgccgcgc gcatccgcga tctgtccagc gcacgcgagc cggaagttca tcgcgtgtcg       480
     ctcggcctga tccagagcgc gagtcacgtc tatcggcaga ttggcggcat gatccggcgc       540
     ctgcggccca tcgggctcga cgagttcggt ttgccgagcg cgctggagca ttgcgtcgac       600
     ggctggcgtg agcggctgcc ggacgcctcg ttttcgctga cgatcgaagg ggacttcacc       660
     gggctgagcg acgcgctcac catcacgctt taccggctcg tgcaggaagg gctcaccaat       720
     gtctcgaagt tcgcccgcac tgcacgcgtg gaagtgttca tggtgcgcgc gccgcgcgag       780
     gcgcgggagc ggcaggacgg caggctcgtc gatgaaatcg tcgtcactat ggccgacgac       840
     ggccccggcg ccgatctcga caagccgcgc ggcggactcg gcctgatcgg catgcgcgag       900
     cgcgtggaag cgctcggcgg cgaatttcac gtggcgagca ggccggaagg cgggttcctg       960
     ttctgcgcgc gggtgcctgc tcacgcaggg cttgccgagc ccgtgaactg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page