(data stored in SCRATCH zone)

EMBL: CP000271.PE56

CP000271.PE56        Location/Qualifiers
FT   CDS_pept        60728..61471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2971"
FT                   /product="Putative fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33024"
FT                   /db_xref="GOA:Q13SB5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB5"
FT                   /protein_id="ABE33024.1"
FT                   /translation="MKLLKKMPIGIGFACALLAGSAQASVTIGGTRVVYPLEQREVTVK
FT                   LDNDSKTPSLVQAWIDDGNADAKPGEIKVPFVITPPIFRMDAKKGQTLRVMYTGEPLPQ
FT                   DRESVYWLNVLDIPPKASSATEVNSLSLAYRTRIKVFARPAGLPGKPEDAAAQLSWKIA
FT                   ASADGKSHALSVSNPTPYYVSFSEIDVESNGHTFRNEQGGMVAPRASAVLPIAKMNAVA
FT                   AGAKVHYIAISDYGGPIDGDAALGE"
     atgaagctgc tcaaaaagat gccgatagga atcggttttg cctgtgcact gctggccggc        60
     agtgcacagg caagcgtgac gatcggcggt acgcgcgtgg tgtatccgct cgagcagcgt       120
     gaagtcacgg tcaagctgga taacgacagc aagacaccct cgctcgtgca ggcctggatc       180
     gacgatggca atgcggatgc caaacccggc gaaatcaaag tgccgttcgt gataacgccg       240
     ccgattttcc gcatggatgc aaaaaaaggg cagacattgc gcgtgatgta caccggcgag       300
     cccttgcctc aggatcgcga gtcggtctat tggctcaacg ttctggacat cccgccgaag       360
     gcaagcagtg cgacggaagt caatagcttg agcctggcgt atcgcacccg catcaaggtt       420
     ttcgcgcggc cggccgggct gcccggcaaa ccggaagacg cggccgccca actgagctgg       480
     aagatcgccg cgtcggcgga tggcaagagc catgcgctca gcgtttcgaa tccgacgcct       540
     tactacgtct cgttcagtga gatcgacgtg gagagcaacg gccacacgtt cagaaacgaa       600
     cagggtggca tggttgctcc acgcgcatcg gcggtcctgc cgattgcaaa gatgaatgcc       660
     gttgccgcgg gcgcgaaggt gcactacatc gccatcagcg actacggcgg tcctatcgac       720
     ggcgatgcgg ctctcggcga gtaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page