(data stored in ACNUC7421 zone)

EMBL: CP000271.PE564

CP000271.PE564       Location/Qualifiers
FT   CDS_pept        668507..669562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2459"
FT                   /product="Conserved hypothetical protein (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33532"
FT                   /db_xref="GOA:Q13QV7"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR024710"
FT                   /db_xref="InterPro:IPR040803"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV7"
FT                   /protein_id="ABE33532.1"
FT                   /translation="MTKIFVYEYLTGGGIDPAHAGAASLADLSALIVEGRVMRDALVSE
FT                   LRELDGVDVSFASSRFETVDPALAHCRAAQGESMTAFVARVAREHDYAWVIAPECDGLL
FT                   LQLYDAVGAARWLGCAKEAIRVASSKSATAALLAAQGVATTPAIEPGQSDVQRGERWVV
FT                   KPDDGAGGLDTFVFDSFADACAEYDARAAAARNPVLQAWVDGEPLSLSLICRADGVELI
FT                   SINRQQISLSANDTSQRQPRIVEFDGVTVNQIDLAGDQGRLLGALAQRVAKAMPGLRGF
FT                   VGIDVVWHPQRGPVVIEVNPRLTVAYAGLSAGARGGDLARTLLAAHGVRVGRSGPAARS
FT                   RGAQSACGARP"
     ttgaccaaga tctttgtcta cgagtacctc accggcggcg gcatcgaccc ggcgcatgcc        60
     ggcgcggcga gtctcgccga cctgagcgcg ctgatcgtcg aaggccgggt gatgcgcgac       120
     gcgctggtga gcgagctgcg tgaactcgac ggcgtggacg tgagcttcgc gagttcgcgc       180
     ttcgaaaccg tcgacccggc gcttgctcat tgtagggccg cgcaaggcga gtcgatgacg       240
     gctttcgtcg ctcgcgtggc gcgcgagcac gattacgcgt gggtcatcgc gccggaatgc       300
     gacggcttgc tgctgcaact gtacgacgcg gtgggcgcgg cgcgctggct cggctgcgca       360
     aaggaagcga tccgtgtggc gtcgagcaag agcgcgacgg cggcgttgct cgcggcgcag       420
     ggtgtcgcca ccacgcccgc gatcgaaccc ggacaatccg atgtgcagcg cggcgagcgt       480
     tgggtcgtga aaccggacga cggcgcgggc ggcctcgata ccttcgtgtt cgacagcttc       540
     gccgacgcgt gcgccgaata cgacgcgcgc gcggcggccg cgcgcaatcc cgtgctgcaa       600
     gcctgggtcg acggcgagcc gctcagtctt tcgctgatct gccgtgccga cggtgtggaa       660
     ctcatcagca tcaaccggca gcaaatcagc ttgagcgcga acgacacgtc gcaacggcaa       720
     ccgcgcatcg tcgaattcga cggcgtgacg gtcaatcaga tcgacctggc cggcgatcag       780
     ggccgcctgc tcggcgcgct cgcacagcgc gtcgcgaagg cgatgccggg cttgcgtggc       840
     ttcgtcggca tcgacgtggt gtggcatccg cagcgcgggc cggtcgtgat cgaggtcaat       900
     ccgcgtttga ccgtggcgta tgcgggtctg tccgcgggtg cgcgcggcgg cgatctcgcg       960
     cgcaccctgc tcgcggcgca cggggtgcgc gtcgggcgat ccgggccggc ggcgcgcagc      1020
     cgtggcgcac agtccgcctg tggggcccgg ccatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page