(data stored in ACNUC7421 zone)

EMBL: CP000271.PE569

CP000271.PE569       Location/Qualifiers
FT   CDS_pept        673033..673431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2454"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33537"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV2"
FT                   /protein_id="ABE33537.1"
FT                   /translation="MFPPGIDTALRRRPGVMPDFIGVGYYASSMPDVRRHGVGSAPARR
FT                   NTAFAELRRRGHRARGTMRLHRALFRECSKVFHDGQRLPLLSRNACNSYANHSLPIASA
FT                   CVENFASWPAFSRSAFSVIDNGSVKSAK"
     gtgtttcctc caggtattga tacagcgttg cgccgtcggc ccggcgtgat gccggacttc        60
     attggcgttg gttactacgc aagctccatg ccggatgttc gacgacacgg cgtgggcagc       120
     gcaccggcgc gccgcaatac agcgttcgcc gaattgcgtc ggcgcggcca ccgggcgcgc       180
     ggcacgatgc ggttgcaccg cgcactgttc cgggaatgca gcaaagtgtt ccatgacggg       240
     caaaggctac cgcttctgtc acgcaatgct tgcaattcct atgcgaatca ttctctaccg       300
     atcgcaagcg catgtgttga gaatttcgct tcgtggcccg cgttttcgcg atccgcgttt       360
     tcggtgatcg ataacggatc ggttaagtct gccaaataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page