(data stored in SCRATCH zone)

EMBL: CP000271.PE57

CP000271.PE57        Location/Qualifiers
FT   CDS_pept        61604..64246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2970"
FT                   /product="Putative fimbrial biogenesis outer membrane usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2970"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33025"
FT                   /db_xref="GOA:Q13SB4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB4"
FT                   /protein_id="ABE33025.1"
FT                   /translation="MKDFPCCRSLVRAGEPGGAFGLNPVAAVVALAFAVLGGVQPIVAQ
FT                   ASGQAEAGAAVEFDSTFLRVDPNATVDVSRFTRGNPMSEGVYSVDVLVNGVRVARHDVR
FT                   FVATSGTATARPCFSRQMLETLGVDFARVAASSDAKTPAETGVTGECVDLAATVPDAMV
FT                   DFDFAEQKIALSVPQKYMRNAARGYVPPDMWQTGVNAAFLSYNANAYHSAGSGVESTQS
FT                   YVGLNAGVNLGAWHFRHQSSVTQQAGAATQFDNIATYLQRDITRIKSQLTVGDGYTTGD
FT                   VFDSVQFRGAQIATDDRMLPESLRGYAPIVRGTAESNARVTVRQNGQVIYETTVSPGPF
FT                   EINDLYATGYGGNLDVTVTEANGRTKSFTVPYASVAQSLRPGTTRFSVTAGELRNSTLE
FT                   TNPNFAQFTLQRGLTNLVTVYGGAVAANGYMAADMGAALNTKFGALSADVTGAQTQIPD
FT                   HGTLRGTSLRIGYSKFIDPTNTNIAIAAYRYSTAGYMNLSDAASVRDLAMHGGNPDSVY
FT                   RQRNRFQVTLNQNFKEYGTVFLNASAQQYWNRSGSDVFYQAGYTNRFKYGTYSISAGRT
FT                   RNSNGSMSDQIMLSTTLPLGRDQHSPLLSANLSSSGGNANLQANVSGSLGERNQFSYSG
FT                   YGAYGDGPGASTASAGASGTYRTPYAQLTGSASGGTGSSQVSAGISGSIVAHPGGVTFS
FT                   QTVGDTFGVIEAPGAAGASVTSSPGVKLNGRGFAVVPYLTPYGINTVDIDPKGTSTDVE
FT                   FESTSEQAVPRLGSVVMIRYKTVTGRAALIRAPQLGDKALPFGADVVDATGRTVGVVAQ
FT                   DSRIFARGLEDKGSLFVKWGASASEQCRIEYVLPRQTGKAGAAYTSVEGHCVGGTPTEN
FT                   TNFASGRTR"
     atgaaggact tcccctgttg ccgctcgctc gttcgcgccg gtgaacctgg cggcgcgttt        60
     gggctcaacc ccgtcgccgc agttgttgcg ctggcgttcg cggtgctggg cggtgtccag       120
     ccgatagtcg cacaggcgtc cgggcaggcc gaagcgggcg cggcagtgga gttcgactca       180
     acttttctgc gcgtcgatcc gaatgcaacg gtggacgtct cgcgcttcac gcgtggcaac       240
     ccgatgtccg aaggcgttta ttccgtcgac gtgctggtca acggtgtgcg tgttgcgcgc       300
     catgatgtgc ggtttgtggc caccagcgga acggctacgg cgcgtccctg tttcagccgg       360
     caaatgctgg aaacgctcgg cgtcgatttt gccagggtcg cggcgagcag cgacgcgaag       420
     acgccggccg aaaccggcgt taccggtgaa tgcgtcgacc ttgcggcgac cgtgcccgac       480
     gcgatggtcg acttcgactt cgcggaacaa aagatcgccc tcagcgtgcc gcaaaagtac       540
     atgcgaaacg ctgcgcgcgg ttacgtgccg cctgacatgt ggcagaccgg agtcaacgcg       600
     gctttcctga gctacaacgc aaacgcgtac cacagcgccg gatcgggcgt tgaatcgacg       660
     cagagctatg tcggcttgaa tgccggggtg aacctcggcg cgtggcactt ccgccatcag       720
     tcgtcggtga cgcagcaagc tggcgcagcc acacaattcg acaacatcgc gacttacctt       780
     cagcgtgaca tcaccagaat aaagtcgcaa ttgacggtcg gcgacggcta cacgaccggc       840
     gatgtattcg acagcgtgca gtttcgcggc gcgcagatcg ccaccgacga ccgcatgctg       900
     ccggaatcct tgcgaggcta cgcgccgatc gtgcgcggca cggctgaatc gaacgcgcgc       960
     gtgacggttc gtcagaacgg ccaggtgatc tatgaaacca ccgtttcgcc gggtccgttc      1020
     gaaatcaacg acctttacgc gaccggctat ggcggcaacc tggatgtcac cgtcaccgaa      1080
     gccaatggcc gtaccaaaag cttcactgtg ccttacgcct cggttgccca gtcattgcgg      1140
     cccggcacca cacggttttc agtcaccgcc ggcgagctcc gcaattccac gctcgagaca      1200
     aacccgaatt tcgcgcagtt cacgctacag cgcgggctga ccaatctggt cacggtctat      1260
     ggtggtgccg tggccgctaa tggttacatg gccgccgaca tgggcgccgc actgaacacg      1320
     aagttcggcg cgctgtcagc cgacgtgaca ggcgctcaaa cgcagattcc ggatcacggc      1380
     acgttgcgcg gcacgagctt gcgcatcggt tacagcaagt tcatcgatcc gaccaacacg      1440
     aacattgcaa tcgcagcgta tcgctattcg acggcggggt acatgaacct gtcggatgcc      1500
     gcgtccgtgc gtgacctcgc catgcacggc ggcaatccgg attcggtgta ccggcagcgc      1560
     aaccgttttc aggtcacgct caatcagaac ttcaaggaat acggcacggt ctttctgaac      1620
     gcttccgccc agcaatactg gaatcgcagc ggcagcgacg tgttctacca ggccggctac      1680
     accaaccgtt tcaagtacgg tacgtacagt atcagcgcgg ggcgcacgcg caactcgaac      1740
     gggtcaatgt cggatcagat tatgttgagt accacgttgc cgctcggtcg cgaccagcat      1800
     tcgccgctgc tgtcggcgaa cctcagcagt tccggtggaa acgccaacct gcaggccaac      1860
     gtgagcggct cgttgggcga gcgcaaccag ttctcgtaca gcgggtatgg ggcgtacggc      1920
     gacggtccgg gcgccagcac ggcgagcgcg ggcgcgagcg gcacctatcg cacgccgtac      1980
     gcgcagttga cgggatcggc gagcggcgga accggctcca gccaggtgtc ggcgggtatc      2040
     agcgggtcga tcgtcgcgca tccgggcggt gtcacgttct cgcagacggt gggtgacacg      2100
     ttcggcgtga tcgaagcacc gggcgcagca ggcgcgagcg tgaccagttc gcccggcgtg      2160
     aaactcaatg ggcgcggctt tgcggtcgtt ccgtacctga caccctatgg catcaacacg      2220
     gtggatatcg atccgaaggg cacgtcgacc gatgtcgagt ttgaatcgac gtcggagcag      2280
     gcggtgccgc ggctgggctc agtggtgatg atcaggtaca agacggtgac cggacgcgcg      2340
     gcattgattc gtgcgccgca actcggcgac aaggcgctgc cgtttggcgc ggacgtggtc      2400
     gatgcaaccg ggcggacggt aggcgtcgtt gcgcaggaca gtcggatttt cgcgcgcggg      2460
     ctcgaggaca aaggctcgct gttcgtgaaa tggggcgcgt cggcttccga gcaatgccgc      2520
     atcgagtacg tgttgccgag gcaaacgggt aaagcaggag cggcctacac gtctgtggaa      2580
     gggcattgtg tgggcgggac accaaccgaa aacacgaact ttgcttctgg ccgtaccagg      2640
     taa                                                                    2643
//

If you have problems or comments...

PBIL Back to PBIL home page