(data stored in ACNUC7421 zone)

EMBL: CP000271.PE570

CP000271.PE570       Location/Qualifiers
FT   CDS_pept        673526..675025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2453"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33538"
FT                   /db_xref="GOA:Q13QV1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13QV1"
FT                   /protein_id="ABE33538.1"
FT                   /translation="MNDFSQPVIDSIHKPRDAANPRERYAAGVMKYREMGYWQPDYAPK
FT                   DTDVIALFRITPQPGVDPEEAAAAVAGESSTATWTVVWTDRLTACDIYRAKAYRVDPVP
FT                   ASNAAEPQYFAYIAYELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKT
FT                   FQGPPTGIVVERERLDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENI
FT                   NSQAFMHWRDRFLFAMEAVNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIV
FT                   MIDLVIGWTAIQSMARWARRNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDH
FT                   AHAGTAVGKLEGDPLSVQGYYNVCRESHNEVDLSRGIFFDQPWAGLRKVMPVASGGIHA
FT                   GQMHQLLDLFGDDAILQFGGGTIGHPAGIQAGAVANRVALEAMVKARNEGRDIVHEGPD
FT                   ILEAAARWCTPLKQALDTWRDVTFNYASTDTPDFAATPTAA"
     atgaacgatt tcagtcaacc ggtgatcgat tccatacaca agccgcgcga cgcggcgaac        60
     cctcgcgaac ggtacgccgc gggcgtgatg aagtatcgcg agatgggcta ctggcagccc       120
     gattacgcgc cgaaagatac cgacgtcata gcgctttttc gcatcacgcc gcagcccggc       180
     gtcgatccgg aggaggcggc ggcggccgtg gccggcgaat cgtcgacggc aacctggacc       240
     gtggtgtgga ccgaccggct gaccgcgtgc gacatttacc gcgcaaaagc ctatcgcgtt       300
     gatccggtgc cggcctcgaa cgccgccgaa ccgcagtatt tcgcgtacat cgcctatgaa       360
     ctggatctgt tcgaagaagg ctcggtcgcc aacctgacgg cgtcgatcat cggcaacgtg       420
     ttcggcttca aaccgctcaa ggcgctgcgt ctcgaagaca tgcgcatacc tgttgcttat       480
     ctgaagacct ttcaggggcc gccgaccgga atcgtcgtcg agcgcgaacg gctcgacaag       540
     tacggacggc cgctgctcgg cgcgaccgtc aagcccaaac tgggtttgtc gggcaagaac       600
     tatggccgcg tcgtgtatga aggattgcgc ggcggtctgg attttctgaa ggacgacgag       660
     aacatcaatt cgcaggcgtt catgcactgg cgcgaccgtt ttctgtttgc gatggaagcg       720
     gtgaatcgcg cgcaggcgga gacgggcgag gtcaagggcc actacctgaa cgtgacggcc       780
     ggcacgatgg aggacatgta tgagcgcgcc gaattcgcca aggaactggg ttcatgcatc       840
     gtgatgatcg atctggtgat cggctggacc gcgattcagt cgatggcgcg ctgggcgcgc       900
     aggaacgaca tgatcctgca cctgcatcgc gcggggcaca gcacctatac gcggcagcgc       960
     aaccacggca tttcgtttcg cgtgatcgcg aagtggctgc gcatggcggg cgtcgatcac      1020
     gcgcatgcgg gcacggcggt cggcaagctc gaaggcgatc cgctctcggt gcagggctat      1080
     tacaacgtgt gccgcgagtc gcacaacgag gtcgacctgt cgcgcggcat tttcttcgac      1140
     cagccgtggg ccggtctgcg caaggtgatg ccggtggcct cgggcggcat tcacgcggga      1200
     cagatgcatc agctgctcga tctgttcggc gatgacgcga tcctgcagtt cggcggcggc      1260
     acgatcggcc atccggccgg tattcaggcg ggcgcggtgg cgaatcgcgt cgcgctcgaa      1320
     gcgatggtga aggcgcgcaa cgagggccgc gacatcgttc acgaggggcc ggacattctc      1380
     gaagccgcgg cgcgctggtg cacgccgctc aagcaggcgc tcgatacgtg gcgggacgtg      1440
     accttcaact acgcgtccac cgacacgccg gatttcgccg ccacgccgac cgcggcctga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page