(data stored in ACNUC7421 zone)

EMBL: CP000271.PE571

CP000271.PE571       Location/Qualifiers
FT   CDS_pept        675134..675562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2452"
FT                   /product="ribulose 1,5-bisphosphate carboxylase small
FT                   subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33539"
FT                   /db_xref="GOA:Q13QV0"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV0"
FT                   /protein_id="ABE33539.1"
FT                   /translation="MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRN
FT                   TYWEMWGLPMFDLRDAAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPD
FT                   EEPGFRLTRQDGPGRVQRYGLSGYAGDRPSGERYGPAR"
     atgcgaatta cacagggcac gttttccttc ctgccggaat tgaccgacga agagatccgt        60
     ttgcagatcg actacgcgct gagccagggc tgggcctgct cggtcgaata caccgacgac       120
     ccgcatccgc gcaacacgta ttgggaaatg tggggcctgc cgatgttcga tctgcgcgat       180
     gcggccggcg tgctgcagga agtgaaggcg tgccgcgcgg cgcagccgca gcactacatc       240
     aaggtcaatg cattcgactc ggtgcgcggc ttcgagacga tgcgcctgtc gttcatcgtc       300
     aaccggccgg acgaagagcc gggcttccgc ctgacgcgcc aggacgggcc gggacgcgtg       360
     cagcgctacg ggttgtcggg ctacgcgggc gaccggccgt cgggcgaacg atacggaccc       420
     gcgcgctag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page