(data stored in ACNUC7421 zone)

EMBL: CP000271.PE572

CP000271.PE572       Location/Qualifiers
FT   CDS_pept        675618..676667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2451"
FT                   /product="CbbX-like protein, putative AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33540"
FT                   /db_xref="GOA:Q13QU9"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU9"
FT                   /protein_id="ABE33540.1"
FT                   /translation="MTEAAAIDANALCSDGRDAAALQDSQDSRAQAPQVDLAALYRDSG
FT                   IGDVLAELDRDLVGLAPVKTRIREIAAHLLVERARDSLGLAGGAPTLHMCFSGNPGTGK
FT                   TTVALRMAEVLHRLGYIRRNHLVSVTRDDLVGQYIGHTAPKTRDVLKRAMGGVLFIDEA
FT                   YYLYRPENERDYGQEAIEILLQTMENQRDDLVVILAGYAARMEVFFESNPGFRSRIAHH
FT                   ITFPDYDGAELLDIAERMLATMHYRFDADSRRAFADYLALRTRQANFANARSVRNALDR
FT                   SRLRQANRLFATAMQGGAPIDAAALTLIAAADVRASRVFTESEALAANAGAPASSHATA
FT                   TRAVTAPPG"
     atgaccgaag ctgccgccat agacgcgaac gcgctatgtt ctgacggacg agacgctgcc        60
     gcgctacagg acagccagga cagccgcgcg caagcgccgc aggtcgatct cgccgccctc       120
     tatcgcgact ccggcatcgg cgacgtgctt gccgaactcg accgcgatct ggtcggcctc       180
     gccccggtga aaacccgcat tcgcgagatc gcggcgcatc tgctcgttga gcgcgcgcgc       240
     gattcgctcg gtctcgcggg cggcgcgccc accctgcata tgtgtttctc gggcaatccc       300
     ggcacgggca agaccacggt cgcgctgcgc atggcggagg tgctgcaccg gctcggctac       360
     attcgccgca atcatctggt gtcggtcacg cgcgacgatc tggtcggcca gtacattggc       420
     cacaccgcgc cgaaaacgcg cgatgtgctg aaacgcgcga tgggcggcgt gcttttcatc       480
     gacgaagcct attacctgta tcgcccggaa aacgaacgcg attacggtca ggaagcgatc       540
     gagatcctgc tgcaaacaat ggaaaaccag cgtgacgatc tggtggtgat tctggccggt       600
     tacgccgcgc gcatggaagt gttcttcgaa agcaatccgg gctttcgctc gcgcattgcg       660
     catcacatca cgtttcccga ctacgacggc gcggaactgc tcgatatcgc cgagcgcatg       720
     ctcgcgacga tgcattaccg cttcgacgcc gactcgcggc gcgctttcgc cgactatctc       780
     gcgctgcgca ccaggcaggc gaatttcgcc aacgcccgct cggtgcgcaa tgcgctcgat       840
     cgctcacggc tgcgccaggc caaccgcctg ttcgccacgg cgatgcaggg cggtgcgccg       900
     atcgacgcag ccgcgctcac gctgatcgcc gccgccgacg ttcgcgcgag ccgcgtgttc       960
     actgaatctg aagcgctcgc ggcgaacgcc ggggcgcctg cgtcctctca tgcaacggca      1020
     acgcgcgccg tgacggcgcc gccaggctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page