(data stored in ACNUC7421 zone)

EMBL: CP000271.PE578

CP000271.PE578       Location/Qualifiers
FT   CDS_pept        complement(682764..683690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2445"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33546"
FT                   /db_xref="GOA:Q13QU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU3"
FT                   /protein_id="ABE33546.1"
FT                   /translation="MLLYSVGVLFSVSGARYVVATIIHHGVHGHLTRKPIVNQALCEVL
FT                   STLLIVQPYESYRRFHVYEHHGRDFSTLNDKDLAAIYKLGFTPGKSKGALYRNLVITLL
FT                   NPAFHLTFFWGRLKSNLVSVRLYRLCMSVLWLISLAVFAAHFGTLFFVAIVVVPYVVVY
FT                   QAASLLHLLTEHVWLLRLPPESVRESHVRNSLGRFCGSACPAGWGIVHLVPWLKWSIAH
FT                   LFFHLPCRMLIVQGSLVCHDWHHRFGSTRQWHDYAALREADAVKLVAEGRYDYTEIWGF
FT                   DHCLDHVFERLSASDAVHVGNLNYRLN"
     atgcttctct actcggtagg cgtgctgttc tctgtctccg gcgcccgtta cgtggtggca        60
     acgatcatcc atcatggcgt acacggccac ctgacccgca agccgatagt caatcaggcg       120
     ctatgcgagg tcctgtccac gttgctgatc gttcagcctt acgagtcata tcggcgattt       180
     cacgtctacg aacaccacgg gcgcgatttt tcgacgctga atgacaaaga tctggcggcg       240
     atctacaaac tgggcttcac gcccggaaaa agcaagggcg cgctgtatcg caatctcgtg       300
     atcacgctgc tcaacccggc attccacctg acgttcttct ggggtcggct caaatccaac       360
     ctcgtaagcg tgcggctata tcgtctttgt atgtcggtcc tctggttgat ctcgctggca       420
     gttttcgcgg cacactttgg cacattgttc tttgtggcga tcgtggtcgt tccgtatgtc       480
     gtggtttatc aggcggcttc cttgctgcac ttgctgacgg aacatgtctg gctcctgagg       540
     ctaccgcctg aaagcgtgcg tgaaagccac gtcagaaaca gtctcgggcg cttctgtggc       600
     tcggcatgtc cggccggttg gggtatcgtc catctcgtgc cgtggctgaa gtggtccatt       660
     gcccatctgt tttttcacct gccgtgccgc atgctcatcg ttcagggctc cctcgtctgc       720
     catgactggc atcaccggtt cggcagcacc cggcagtggc acgactatgc cgccttgcgt       780
     gaggcggatg ccgtcaaact ggtggcggaa ggcagatacg actacacgga aatctgggga       840
     ttcgatcatt gcctggatca tgtcttcgaa cgcctcagtg catctgatgc cgtgcatgtt       900
     ggaaatctga actaccggct caactga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page