(data stored in ACNUC7421 zone)

EMBL: CP000271.PE579

CP000271.PE579       Location/Qualifiers
FT   CDS_pept        complement(683951..684262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2444"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33547"
FT                   /db_xref="GOA:Q13QU2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU2"
FT                   /protein_id="ABE33547.1"
FT                   /translation="MSWWLILTLAAVVFFNRYVFLEPKVPVKLPRLLSNALEYSAPCLL
FT                   TAICAPIILMDKGLLRSFPGNPYFLGAAFSVVFALVIRSVVLSVVMSLAVFYLLARFL"
     atgagctggt ggctgatcct gactctggcg gcggttgttt tcttcaaccg atatgtattt        60
     ctggaaccca aggttccagt caaactgccc cgtcttttga gcaatgcgct cgaatattcg       120
     gctccctgcc tgctcacagc gatttgtgcg ccgatcatcc tgatggataa aggcttgctt       180
     cgcagttttc cgggtaaccc ttacttcctg ggcgcggcgt ttagcgtcgt cttcgcactc       240
     gtgatccgca gcgtcgtgct gtctgtcgtc atgagtctcg ccgtttttta tctgcttgcg       300
     cgattcctgt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page