(data stored in ACNUC7421 zone)

EMBL: CP000271.PE58

CP000271.PE58        Location/Qualifiers
FT   CDS_pept        64382..65398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2969"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2969"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33026"
FT                   /db_xref="GOA:Q13SB3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB3"
FT                   /protein_id="ABE33026.1"
FT                   /translation="MCLTLVLGSALFAARPAHAALICNASGANNVISAGSISVPANPTI
FT                   GATIATLAPTQFQMPCRFDTSAPVETSATLWATFDSSLPPVSGFADVYQTNVQGLGIRY
FT                   TFNAPACNANNVPMTSGEVKLTCPVSGPVDGPYMPIDVTVTPSFVATGVIPLGARTLST
FT                   VPLVSIVYWTSDDPATGWDKPPLYTGAASGRIIHACAINQPDASVTLPTVNSSAFSGGV
FT                   GSVAGPQSFSLVFSCGSGAQVSIVLTDNTDPSNRSNVLTPTPDSTAKGIGIQILNDSGA
FT                   PVSFGPDSSEPFTTNQWVIGRSPDGRLEVPLIARYIRTGNVVAGAIRALATFTMSYQ"
     gtgtgcctca cgctagtact tggctccgcc ttgttcgcag cccggccagc gcacgcggca        60
     cttatttgta atgctagcgg cgcgaataac gtcatcagtg caggatcgat ctccgtgccc       120
     gccaatccga cgatcggtgc gacgattgcc acgcttgcgc ccacgcagtt tcagatgccc       180
     tgcagattcg acacttcagc tccggtagag acgtctgcta cgctttgggc aacctttgac       240
     agttcactac cacctgtatc cgggtttgcc gacgtatatc aaactaacgt tcagggtctg       300
     ggaatccggt acacgtttaa cgcgccggcg tgcaatgcga acaatgttcc aatgaccagc       360
     ggcgaggtca agctgacctg cccggtcagc ggacctgtgg atggtccgta catgccaatt       420
     gacgtcacgg ttacgccgtc atttgttgcc actggcgtaa tacctctggg tgcacggacg       480
     ctttccaccg tgccgttggt gtcgatcgtg tattggacgt ctgacgatcc agccacggga       540
     tgggacaaac cacctctcta caccggcgct gcgtccggcc ggatcattca cgcctgtgcg       600
     atcaatcagc ccgacgcttc cgttaccctg ccgacggtca acagtagtgc attctccggc       660
     ggcgtcggca gcgtggcggg cccgcaatca ttctcgctag tgttttcgtg tgggagtggt       720
     gcgcaggtat ctatcgtttt aacggacaat acggatccgt ccaaccggtc gaacgttctc       780
     accccgaccc cggactcgac cgcaaagggg attggcattc agatattgaa tgacagcggc       840
     gcgccggtgt cgttcggacc ggactcgtcg gagcccttca cgaccaacca atgggtcatc       900
     ggcaggtcac cggacggtcg gctggaggtg cctttgatcg cgcgatatat tcgaacgggc       960
     aacgtggtgg ccggcgcgat cagagcgctc gccactttca ccatgtcata tcagtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page