(data stored in ACNUC7421 zone)

EMBL: CP000271.PE580

CP000271.PE580       Location/Qualifiers
FT   CDS_pept        complement(684259..684999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2443"
FT                   /product="Putative branched-chain amino acid exporter,
FT                   LIV-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33548"
FT                   /db_xref="GOA:Q13QU1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU1"
FT                   /protein_id="ABE33548.1"
FT                   /translation="MTRNKNTLECASGAHERDLAHGGAFLGALNMLPLCLSVLPWGILA
FT                   GSMAVQSGLTLWQSIGMSAIVFAGAAQLVTLGLHMSGASALTIIVSVFLITAQHFLYGL
FT                   NLRGYVSTLRKRHRLPIGFLLTDELFALSSASKIKSQLTPGYLIGAGLAFYLSWNLFSL
FT                   LGIFTAASVPDLSRYHLDFSIVATFAAIVIPMIRKISVLSGVLFSLLTSMLLSYFHVGG
FT                   AIVIAGVSGMFFSSFVARLRKEAP"
     atgacacgta ataaaaatac tctcgagtgc gcttcaggcg cacatgagcg cgacctcgcc        60
     cacggcgggg cttttctcgg cgctcttaac atgttgcctc tctgtctctc cgtcctgccg       120
     tggggaatac tcgccggctc gatggcggtg cagtccgggc tgaccctgtg gcaaagcatt       180
     ggtatgtcgg cgatcgtctt cgccggcgcc gcgcagctcg tgacactcgg attgcatatg       240
     tccggcgcaa gcgcattgac catcatcgtt tcggttttcc tgatcaccgc ccagcacttt       300
     ctctatgggc tgaaccttcg aggctacgtg tcgactctgc gcaaacgtca ccggctgcct       360
     atcggctttc tgctcaccga cgaactcttt gcactcagca gcgccagcaa aataaaaagt       420
     caattgacac ctggctatct gatcggggcg ggactggctt tttatctgag ctggaatctc       480
     ttcagcctgc ttggaatctt cacagccgct tccgtcccgg atctgagccg ctaccacctc       540
     gatttttcca ttgtggccac gttcgccgca atcgtgatcc ccatgatccg gaaaatcagc       600
     gtgctttcgg gcgttctgtt ttcgctgctg acttccatgc tgctgtccta ttttcatgtg       660
     ggcggcgcga tcgtgattgc cggcgtgagc ggcatgttct tctcgtcgtt tgtcgcgcgc       720
     ctgcggaagg aagcgccatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page