(data stored in ACNUC7421 zone)

EMBL: CP000271.PE586

CP000271.PE586       Location/Qualifiers
FT   CDS_pept        complement(691332..691739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33554"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT5"
FT                   /protein_id="ABE33554.1"
FT                   /translation="MTIRCRALAACACFALATTLAWADGDAPTAPAPAGGYNYPTQGRV
FT                   EYVLSCMDDNGHDFVNVYKCSCVIDKMATALSYDDFVAQSTFSKYATLGGEGGSEFRVD
FT                   HAKAQTKKFRTLQTQAYHSCGLGPDKTASAK"
     atgaccatac gatgtcgtgc gctggccgcc tgcgcctgct tcgcgctcgc aacgacgctc        60
     gcctgggcgg acggcgacgc gcccacggcg ccggccccgg cgggaggcta caactacccg       120
     acgcaggggc gcgtcgaata cgtgttgagc tgcatggacg acaacggaca cgatttcgtg       180
     aacgtctata aatgctcgtg cgtgatcgac aagatggcca ctgcgctgtc ctacgacgac       240
     ttcgtcgccc aatcgacctt ctcgaagtac gccaccctgg gcggcgaagg cggttcggag       300
     ttccgggtcg accacgcgaa agcacagaca aagaaattcc gcacgctgca gacccaggcc       360
     tatcacagtt gcggactcgg ccccgacaag acggcgtcgg cgaaatag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page