(data stored in ACNUC7421 zone)

EMBL: CP000271.PE59

CP000271.PE59        Location/Qualifiers
FT   CDS_pept        65686..67287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2968"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33027"
FT                   /db_xref="GOA:Q13SB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB2"
FT                   /protein_id="ABE33027.1"
FT                   /translation="MSVSELKRRRTFAVISHPDAGKTTLTEKLLLFSGAIQIAGTVKGR
FT                   KSNRYATSDWMEIEKQRGISVASSVMQFEYGDAVINLLDTPGHEDFSEDTYRVLTAVDA
FT                   AVMVIDGANGVEAQTLKLLEVCRSRKTPIVTFINKLDREVREPLELLDEIEQHLGVAAV
FT                   PFTWPIGMGKDFQGVYDIQRDQVRLFRAGQDKAGGEVETLQALSDEEGERRFGHAWVKA
FT                   KEEIDLITGASPDFDREQFLAGQQSPVLFGSAINNFGVKEILDALVDLAPPPSMRMTVQ
FT                   RPVMPDEPKFTGVVFKVQANMDLAHRDRVAFIRVCSGHFERGMAVKVTRTSKTFRANNV
FT                   VTFLSQRRETVSEAYPGDIIGIPNHGTLSLGDTLTEGEQLQFVGLPFFAPEIFQTVEVV
FT                   DPMRAKQLGEALKQLGEEGAIQVFRPEVGGLMILGAVGQLQFEVVSHRLSTEYKVDVRM
FT                   APARYRMSRWVTCDDAAELRRFTDSYAARIALDASDAPTYLASHVSEIEVAQKAWPKIV
FT                   FNELREHSGAPFKRAM"
     atgtcagtct ccgaactcaa acgccgccgc acgttcgcgg tcatttccca cccggacgcg        60
     ggtaagacca cgctcacgga aaagctgctg ctgttttcgg gcgcgattca gatcgccggc       120
     accgtgaagg gccgcaagag caatcgctac gcaacgtccg actggatgga gatcgaaaag       180
     cagcgcggca tttcggtggc gagttcggtg atgcagttcg agtacggcga cgccgtcatc       240
     aatctgctcg acacgccggg ccacgaagac ttctccgaag atacctaccg cgtgctgacc       300
     gcggtcgatg cggccgtgat ggtgatcgac ggcgcgaacg gcgtcgaagc gcaaacgctc       360
     aagctgctcg aagtctgccg tagccgcaag acgccgatcg tcaccttcat caacaagctc       420
     gaccgcgaag tgcgcgagcc gctcgaactg ctcgacgaaa tcgagcagca tctgggcgtc       480
     gccgccgtgc cgttcacgtg gccgatcggc atgggcaagg atttccaggg cgtctacgac       540
     atccagcgcg atcaggtgcg cctgttccgc gccggccagg acaaggcggg cggcgaggtc       600
     gaaacgctgc aggcgctcag cgacgaagag ggcgagcgcc gcttcggcca tgcctgggtc       660
     aaggcgaagg aagagatcga tctgatcacg ggcgcgtcgc cggatttcga tcgtgaacag       720
     ttcctcgccg gtcagcaatc gcccgtgctg ttcggctcgg cgatcaacaa cttcggcgtg       780
     aaggaaattc tcgacgcact ggtcgatctg gcgccgccgc cttccatgcg catgacggtg       840
     cagcgtcccg tgatgccgga cgagccgaag ttcaccggcg tcgtgttcaa ggtgcaggcg       900
     aacatggatc tggcccaccg cgaccgcgtg gcgttcatcc gcgtgtgctc ggggcatttc       960
     gaacgcggca tggccgtgaa ggtgacgcgc acgagcaaga cgttccgtgc gaacaacgtg      1020
     gtgacgttcc tgtcgcagcg ccgcgagacg gtgagcgagg cgtatccggg cgacatcatt      1080
     ggtattccga accatggcac gctgagtctc ggcgacacgc tgaccgaagg cgagcagttg      1140
     caattcgtcg gcctgccgtt cttcgcaccg gaaattttcc agacggttga agtggtcgat      1200
     ccgatgcgcg ccaagcagct cggcgaagcg ctcaagcaac tcggcgaaga aggcgcgatc      1260
     caggtgttcc gtccagaagt gggcggtctg atgattctcg gcgcggtcgg gcaattgcag      1320
     ttcgaagtgg tgtcgcaccg tttgtcgacc gaatataagg tcgacgtgcg catggcgccg      1380
     gcgcgttacc gcatgtcgcg ctgggtaacc tgcgacgatg ccgccgaact gcgccgcttc      1440
     accgattcat acgcggcacg gattgcgctc gacgcttcgg atgcgccgac ttatctggcg      1500
     tcgcacgtgt cggagatcga agtcgcgcag aaggcctggc cgaaaatcgt cttcaacgaa      1560
     ttgcgcgagc attctggcgc gccgttcaag agggcgatgt aa                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page