(data stored in ACNUC7421 zone)

EMBL: CP000271.PE595

CP000271.PE595       Location/Qualifiers
FT   CDS_pept        699388..699711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2428"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33563"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS6"
FT                   /protein_id="ABE33563.1"
FT                   /translation="MTGQSGARAAGAGVLLLPAARRTRFVPASDTVCPTCRGAAVTVVT
FT                   RTRRVPRRAARAGELLSVNDAHGGSIPAWNMRWPSCAIKPGNDRETALIVTRIRGGAPD
FT                   ATR"
     ttgacgggcc agtcgggcgc tcgcgccgcg ggtgcgggcg ttctgttgct gcctgctgcg        60
     cgacggacac gcttcgtacc ggcgagtgac acagtatgtc ccacgtgccg cggcgcagcc       120
     gtcacggtgg tgacacgtac gcgccgcgtg ccgcgccgcg cggcgcgcgc cggcgagctt       180
     ctgtctgtga acgatgcgca cggtggttcg attccggcat ggaatatgcg ttggccgtca       240
     tgcgccataa agcccggcaa cgatcgggaa acggcgctga tcgttacccg cattcgagga       300
     ggcgcgcccg atgcgacgag gtag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page