(data stored in ACNUC7421 zone)

EMBL: CP000271.PE596

CP000271.PE596       Location/Qualifiers
FT   CDS_pept        699757..701574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2427"
FT                   /product="Methanol dehydrogenase-like protein (xoxF)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33564"
FT                   /db_xref="GOA:Q13QS5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS5"
FT                   /protein_id="ABE33564.1"
FT                   /translation="MNLRTTVLGLAILASAALSSFVAQADSQLDGLMKNPSNWAAQAGD
FT                   YANHRYSPLKQINENNVGKLQVAWTMSTGVLRGHEGAPLVIGDTMYIHSPFPNKVIAIN
FT                   LKDQTFIWQYLPKQDDQVVSVMCCDTVNRGLAYGDGKIFLQQADTKLVALNAKTGDVVW
FT                   TAQNGNPKAGETNTNAPHVFGDKVLTGISGGEFGVRGRLIAYDIKTGKPAWTAYSTGPD
FT                   KDMLIDPDKTTTYADGKMVPVGADSSLKSWKGDQWKLGGGTTWGWYAWDPKLNLVYYGT
FT                   GNPGTWNPTQRPGDNKWSMSIFARDLNTGQARWVYQMTPHDEWDYDGVNEMILSDLSID
FT                   GKKVPAIVHFDRNGFGYTLNRETGQLLVAQKFDPAVNWADHVDMKSGKPIRNAAYSTQA
FT                   AGSDHNVKGICPAALGSKDQQPAAYDPGSSLFLVPTNHVCMDYEPFDVDYVSGQPYVGA
FT                   TLSMYPGPNDNNSMGNFIAWDASKGKIVWSKPERFSVWSGVLATAGGVAFYGTLEGYIK
FT                   AVRIKDGKELWRFKTPSGIIGNVFTYEYQGKQFIGVYSGIGGWAGIGMAAGLEKSTEGL
FT                   GAVGGYRELAKYTALGGTLFVFAIPGGNS"
     atgaacttac gcaccacggt tcttgggctc gcgatcctcg cgtcggcagc cttgagttcg        60
     ttcgttgcac aggccgattc gcagctcgac gggctcatga agaatccgtc caactgggcc       120
     gcgcaggcgg gcgactatgc caaccatcgc tacagccctc tcaagcagat caacgaaaac       180
     aacgtcggga aactacaggt cgcgtggacc atgtcgaccg gcgtgctgcg cggccacgaa       240
     ggcgcgccgc tcgtgatcgg cgacaccatg tatatccact cgccatttcc taacaaggta       300
     atcgctatca acctgaagga tcagacgttc atctggcagt acctgccgaa acaggacgat       360
     caggtggtgt ccgtgatgtg ctgcgatacc gtcaaccgcg ggctcgcgta tggcgacggc       420
     aagatcttcc tgcagcaggc cgacaccaaa ctcgtcgcgt tgaacgccaa aaccggcgac       480
     gtggtctgga ccgcgcaaaa cggtaatccc aaggcaggtg aaaccaacac caacgcgccg       540
     cacgtattcg gcgacaaggt gcttaccggc atttccggcg gcgagttcgg cgtacgcggg       600
     cgtctcatcg cgtacgacat caagaccggg aaaccggcct ggacggccta cagcacgggc       660
     ccggacaagg acatgctgat cgatcccgac aagacgacga cgtatgccga cggcaagatg       720
     gtgccggtgg gcgcggactc gtcgctgaag tcgtggaagg gggaccagtg gaaactgggc       780
     ggcggcacca cctggggctg gtacgcgtgg gatccgaaac tcaaccttgt ctactacggc       840
     accggcaatc cgggtacatg gaatccgacg cagcgtccgg gcgacaacaa atggtcgatg       900
     tccatctttg cgcgcgatct gaataccggt caagccagat gggtctacca gatgacgccg       960
     cacgacgagt gggactatga cggcgtcaac gaaatgatcc tgtcggacct gtcgatcgac      1020
     ggcaaaaagg ttccggctat cgttcacttc gaccgtaacg gtttcggcta cacgttgaat      1080
     cgcgagaccg gccagttgct ggttgcgcag aagttcgacc cggcggtgaa ctgggccgat      1140
     cacgtcgaca tgaagagcgg caagccgatt cgcaacgccg cctattcgac gcaggcagcc      1200
     ggttcggacc acaacgtgaa gggcatctgt ccggcggcgc tcggctcgaa ggaccagcag      1260
     cccgcggcgt acgaccccgg ttccagcctc ttcctcgtgc cgaccaacca cgtttgcatg      1320
     gactacgaac cgttcgatgt cgactacgtg tcgggccagc cgtatgtggg cgccacgctg      1380
     tctatgtatc cgggcccgaa cgacaacaac tcgatgggta acttcattgc ctgggatgct      1440
     tcgaagggca agatcgtctg gtccaagccg gagcggttct cggtatggtc gggcgtgctg      1500
     gccaccgcag gcggcgtggc tttctacggc acgctggaag gctacatcaa ggcagtccgc      1560
     atcaaggacg gcaaggaact gtggcgcttc aagacgccgt cgggaatcat cggcaacgtc      1620
     tttacctacg agtatcaggg caagcagttc atcggcgtct actcgggtat tggcggctgg      1680
     gccggtatcg gcatggcggc gggtctcgag aagtcgacgg aaggcctggg cgcggtgggc      1740
     ggttatcgcg agctcgcgaa gtacacggca ttgggcggca cgctcttcgt gttcgccatt      1800
     cccggcggca acagctag                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page