(data stored in ACNUC7421 zone)

EMBL: CP000271.PE597

CP000271.PE597       Location/Qualifiers
FT   CDS_pept        701756..702175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2426"
FT                   /product="Putative methanol dehydrogenase-like protein,
FT                   cytochrome cL (xoxG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33565"
FT                   /db_xref="GOA:Q13QS4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS4"
FT                   /protein_id="ABE33565.1"
FT                   /translation="MKGRSILLRAALPAVFVVLPAAFAQTNPAIAQVAYKVVDGSKVDP
FT                   NTLQGWKTWRALACERCHGAQQQGMVGPSLVDAFKTLDKTEFHRTVFGGRVDKGMPDFS
FT                   SSQMMQKNWENLYAYLKGRSDGQIKPGDLQAIDSK"
     atgaaaggcc gatcaatcct gttacgggcg gcactgcccg ccgttttcgt cgtactgccc        60
     gctgcgttcg cccagaccaa tcccgcgatt gcccaggtgg cgtacaaggt ggtcgacggc       120
     agcaaggtcg accccaatac gctgcaaggt tggaagacct ggcgcgccct ggcctgcgaa       180
     cgctgtcatg gcgcgcagca acaggggatg gtcggacctt cgctcgtcga tgcgttcaag       240
     acgctggaca agaccgagtt tcaccgcacc gtgttcggtg gccgcgtgga caagggcatg       300
     cccgacttca gttcgagcca gatgatgcag aagaactggg agaaccttta cgcctatctg       360
     aaagggcgtt ccgacggcca gatcaagccg ggcgatctgc aggccatcga ctcgaaatag       420
//

If you have problems or comments...

PBIL Back to PBIL home page