(data stored in ACNUC7421 zone)

EMBL: CP000271.PE598

CP000271.PE598       Location/Qualifiers
FT   CDS_pept        702206..703117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2425"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33566"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS3"
FT                   /protein_id="ABE33566.1"
FT                   /translation="MRHGKRMPTHVAIVTAALCYAAIASGAVRAQGEAMPNNDGADGVL
FT                   RVCADPNNMPLSNNKGEGYENRIASQMASDFGYKLEYTYFPQRMGFVRHTLREKVPDTE
FT                   RYKCDLIIGVPKGYDMTSTTQPYLRSTYAMVFTKRPELAGINTPDDLLKLPPDQLHKLR
FT                   FGIFTQTPAVDWLLSHDLIDQAVSYQVQSGDPQEYPGQMIEKDLQAGNVDVVFLWGPIA
FT                   GYFAKRSGDTVKLVPFPATPGIRFDYTISMGVRYGEKAWKDKVDQWIGANHDKIDNILT
FT                   SYEVPLLKPVDTPAGKPADGSP"
     atgcgtcacg gcaaacgaat gcccacgcac gtcgcaatcg taaccgccgc gctgtgctat        60
     gcggcgattg caagcggcgc ggtgcgcgcc caaggcgagg caatgcccaa taacgatggc       120
     gccgatggcg tgctgcgggt ctgcgcggac ccgaacaaca tgcccttgtc caacaacaag       180
     ggcgagggct acgagaaccg cattgccagc cagatggcga gcgatttcgg ctacaagctc       240
     gaatacacgt attttccgca gcgcatgggc tttgtgcggc acacgttgcg cgagaaggtg       300
     ccggataccg agcgctacaa gtgcgatctg atcatcggcg tgccgaaggg ctacgacatg       360
     acctcgacga cgcagcctta tctgcgctcc acgtatgcaa tggtctttac gaagcggccc       420
     gaactggccg gcatcaatac gccggacgat ctgctcaagc tgccgccgga ccagttgcac       480
     aaactgcgct ttggcatctt cacgcagacg cccgcggtcg actggctgct cagccatgat       540
     ctgatcgatc aggcggtgtc gtatcaggtg caaagcggcg atccgcagga ataccccggc       600
     cagatgatcg aaaaggatct gcaggcgggc aacgtggacg tggtgttcct gtgggggccg       660
     attgcgggct acttcgcgaa gcgctccggc gatacggtca agctcgtgcc gttcccggcc       720
     acgccgggga tccgcttcga ctatacgatc tcgatgggcg tgcgctacgg cgaaaaagcg       780
     tggaaggaca aggtcgatca atggatcggc gcgaaccacg acaagatcga caacatcctc       840
     accagttacg aagtgccgct tctgaagcct gtcgatacgc cggcaggcaa gcccgcggac       900
     gggtcgccat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page