(data stored in ACNUC7421 zone)

EMBL: CP000271.PE599

CP000271.PE599       Location/Qualifiers
FT   CDS_pept        703183..703887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33567"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS2"
FT                   /protein_id="ABE33567.1"
FT                   /translation="MCATHSAAFAAGADEISAAERLIFTTDHLHGIQQQTELDYAFLST
FT                   DQPAHSTDVVKVLVVSPDNAKGDAQVSDHSGAVPLPNAGLQCNPVIIYFLERDIAEMEH
FT                   LTGGQRRYFQQRLRLALAAGPKIETVTSQVGGKPVKARQIVVQPYLGDPNSERFAQYIG
FT                   KRYTFLIADTVPGEVALIRTDVPGANNDFAHPLQTQTLSFQAALRKLPPPPNAPNAPNV
FT                   PLKPSDAPRASR"
     atgtgtgcga cgcacagcgc ggcgtttgcc gcgggcgccg acgaaatctc cgccgccgag        60
     cggctcatct tcacgacgga tcatctgcat ggcatccagc agcagaccga gctcgactac       120
     gctttcctca gcacggacca gccggcgcac agtacggacg tggtcaaggt gctggtggtg       180
     agcccggaca acgccaaagg cgatgctcag gtatccgatc acagcggcgc tgtgccgttg       240
     ccgaacgccg gcttgcagtg caatccggtg atcatctatt tcctcgaacg cgacatcgcg       300
     gagatggagc atctgaccgg tggccagcgc cgttacttcc agcagcgcct gcgcctcgcg       360
     ctcgcagcgg ggccgaagat cgagacggtg acgagccagg tgggcggcaa gcccgtgaag       420
     gcgcggcaga tcgtcgtgca accgtacctg ggcgatccca attcggaacg tttcgcgcaa       480
     tacatcggca agcgctacac gttcctgatt gccgatacgg tgccgggcga ggtcgcgctg       540
     atccgcaccg acgtgcccgg cgcgaacaac gatttcgcgc acccgttgca gacgcaaacg       600
     ctgagcttcc aggcggcgct gcgaaaactg ccgccgccgc cgaacgcgcc gaacgcgccg       660
     aatgtgccgt tgaagccttc cgacgcgccg cgtgcgagcc gttag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page