(data stored in ACNUC7421 zone)

EMBL: CP000271.PE6

CP000271.PE6         Location/Qualifiers
FT   CDS_pept        complement(8112..8507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32974"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG5"
FT                   /protein_id="ABE32974.1"
FT                   /translation="MNDLITDSTDHALAALRYQTAARDLERIVRNIAARYIVQEVPLTW
FT                   RLLHAIEAEALADLGFASRHDALMLGLFQRPSGLPYPETDEAVDFGTSTALPAVFAFAV
FT                   SAYEEAARRAAQASQNTALRHARAWGD"
     atgaacgacc tgataaccga ctcgaccgac cacgctctgg ccgcgctgcg ctatcaaacc        60
     gcggcgcgtg atctcgaacg catcgtgcgc aatatcgccg cgcgctacat cgtgcaggaa       120
     gtgccgctga catggcgttt gctgcacgcg atcgaagctg aagcgcttgc agacctaggc       180
     ttcgccagcc ggcacgacgc gctgatgctg ggcctctttc aacggccgtc cggtctgcca       240
     tatccggaaa cggacgaggc cgtggacttc ggcacctcca cggcgttgcc ggcggttttc       300
     gcgtttgccg tcagcgccta tgaagaggcg gcacgccgcg ccgcacaagc ttcgcagaac       360
     acagccctca gacacgcacg cgcgtggggt gactga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page