(data stored in ACNUC7421 zone)

EMBL: CP000271.PE603

CP000271.PE603       Location/Qualifiers
FT   CDS_pept        706691..707560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2420"
FT                   /product="Putative MxaS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33571"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR8"
FT                   /protein_id="ABE33571.1"
FT                   /translation="MNGTAEFHYRLPMRAGGFRPGSHPGSSFGAGQEFAMHGRLFDYPD
FT                   PRRLDLRASVRAARSEWLVRVHLQRAAVPVQVIVDVSASMHFGKRRTKSQVAADFVEAL
FT                   GYSAFRVGDPLGMLAFDTRARDDLFMPARYGRGVGNLLATMLRESESASDAAGSGGIAG
FT                   LQRAASALAGRQALIFLVSDFHWPLAALPAVLDLLVHACVVPIVVWDAAEIAPPNGGSL
FT                   LAVNDAESARQRTLWLRGSVRERWREAVARRRAELANVFGKRGIQPFYVESAFDPEAMS
FT                   RYFLETIA"
     atgaacggga cagcggaatt tcactaccgt ttgccgatgc gcgcaggcgg atttcgtccc        60
     ggctcgcatc cgggatcgag tttcggcgcc ggccaggaat tcgcgatgca cgggcgtctc       120
     ttcgattacc cggatccgcg ccgcctggat ctgcgcgcga gcgtgcgcgc cgcgcgctcg       180
     gagtggctgg tgcgggttca tctgcagcgc gccgccgtgc cggtgcaggt gatcgtcgat       240
     gtctcggcgt cgatgcactt cggcaagcgc cggacgaagt cgcaggttgc cgcggacttt       300
     gtcgaagcgt tgggatacag cgcgttccgt gtcggcgatc cgttgggcat gctcgccttc       360
     gacacccgcg cgcgcgacga tcttttcatg ccggcgcgat atggccgcgg cgtcggcaac       420
     ctgctcgcga cgatgttgcg cgagagtgag agcgcgagcg acgccgccgg aagcggtggc       480
     atcgccgggc tgcaacgcgc cgcttcggcg ctggccggac ggcaggcgct gattttcctc       540
     gtttcggatt ttcattggcc actcgccgca ttgccggccg tactcgattt gctggttcac       600
     gcctgtgtgg tcccgatagt ggtctgggat gccgctgaaa tcgccccgcc gaacggcggt       660
     tcgctgctcg cggtcaacga tgcggagtcc gcccggcagc gcacgctatg gctgcgcggc       720
     agcgtgcgcg agcgttggcg cgaggccgtt gcgcggcggc gcgcggagct cgcgaacgtg       780
     ttcggcaagc gcggcatcca gccgttttat gtcgagagcg cttttgatcc ggaggcgatg       840
     tcgcgctact ttctggagac gatcgcatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page