(data stored in ACNUC7421 zone)

EMBL: CP000271.PE604

CP000271.PE604       Location/Qualifiers
FT   CDS_pept        707557..708516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2418a"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2418a"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33572"
FT                   /db_xref="GOA:Q13QR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR7"
FT                   /protein_id="ABE33572.1"
FT                   /translation="MRPDGRGVGRSGRSLCEASGATRFVSALALTLTLVLALAPAISVA
FT                   AGSGDVLQPTVQEPRAFGHLLGDIVTQRILLRAGDNDVGSVAPPSIGRTGAWLERRPAR
FT                   IETDAEGRRWMAIDYQIVNVAPTLTRIALPALTLTSASGATLQVAEWPLSIGPITSADA
FT                   FEAGDLQRMRPDRQAPLMPTAPLRRQAAFALGLLLLTLLSWAGWWLWRNWRESARLPFA
FT                   RAWRQMRRLDGPNADMSADAWLCLHRALNETAGHVVHAGSLPSLFARAPYLQPLHAQLE
FT                   QFYQQSGERFFTPAPALAPYPLRGLCRALYRAEQRHQR"
     atgagacctg acgggcgcgg cgttggcaga tcaggaaggt cgctttgcga ggcgtcaggc        60
     gcaacgaggt ttgtctcggc gctcgcgttg acgttgacgt tggtgttggc attggcgcct       120
     gcgataagcg tcgctgccgg ctcgggcgat gtccttcagc cgacggttca ggagccgcgt       180
     gctttcggcc atctgctcgg cgacatcgtc acgcaacgca tcctgctgcg cgccggcgat       240
     aacgatgtcg gttcggtcgc gccgccttcc ataggccgca ccggcgcgtg gctcgaacgg       300
     cggcctgcgc ggatcgaaac cgatgccgaa ggtcggcggt ggatggcaat cgactaccag       360
     atcgtcaacg tcgcgcccac gctcacccgg attgcgttgc cggcattgac attgacctcg       420
     gcatccggtg cgacgctgca ggttgcggag tggccgctca gcatcggtcc gataacctct       480
     gccgacgcct tcgaggccgg cgacctgcaa cggatgcggc ccgaccggca ggctcccttg       540
     atgccgaccg cgccgctgcg aaggcaggcg gctttcgcgc tcggcctgtt gctgctgacg       600
     ttgctctcgt gggccggctg gtggctgtgg cgcaactggc gcgagtcggc gcggctgcct       660
     ttcgcgcgcg cctggcggca gatgcggcgc ctggacgggc cgaacgccga catgtccgcg       720
     gacgcgtggc tttgcctgca ccgcgcactg aacgaaacgg ccggccatgt cgttcacgcg       780
     ggttcgctgc ccagcctgtt cgcgcgagcg ccgtatttgc agccgctaca cgcgcagctc       840
     gaacagttct atcagcaatc cggcgagcgg tttttcacgc ccgcaccagc gctagcgcct       900
     tatccattgc gggggctatg ccgcgcgctg tatcgcgcgg agcagcgcca tcaacgatga       960
//

If you have problems or comments...

PBIL Back to PBIL home page