(data stored in ACNUC7421 zone)

EMBL: CP000271.PE605

CP000271.PE605       Location/Qualifiers
FT   CDS_pept        708513..709499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2418"
FT                   /product="Putative MxaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33573"
FT                   /db_xref="GOA:Q13QR6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR6"
FT                   /protein_id="ABE33573.1"
FT                   /translation="MNTVFDFAYPWLLVLLPLAALPLLRRRGDALAFSWVAWLPDDRIG
FT                   QWIGLIGRGSAVLAMVAIVFGLAGPGRSQRQVLRTGSGAQILILMDRSASMDETMNSKG
FT                   VESPAGESKNKVARASLTNFVAQRPNDRLAFMMFGTSPVLAMPFTYDHRAIAAAIAGTA
FT                   VGRGMPDTQLDRGLLAAIGEFNGRASSGRRAIVLVSDGGARLDTQVRRLIQDGLTRNQI
FT                   ALYFIYLRSGTYSPDLNAAVPANESSAEAELHRYFLSLKTPYRLFQAGNARAMKDAMAE
FT                   INRQQNARTSFVERLPRQDLSPYCFAVALSACVLLLTLRLLQVRVWS"
     atgaacacgg tgttcgactt tgcctatccg tggctgctcg tgctgttgcc gctggccgcg        60
     ctgccgttgt tgcgacggcg cggcgacgcg ctcgccttct cctgggttgc atggctgccg       120
     gacgatcgca tcggacaatg gatcggcttg atcgggcgcg gcagtgccgt gctggcgatg       180
     gtggctatcg tgttcggcct ggctggtccg ggacgctcgc agcggcaggt gctgcgtacg       240
     ggcagcggag cccagattct gatcctgatg gatcgcagtg cgagcatgga cgaaacgatg       300
     aacagcaaag gcgtagagtc gccggcgggc gagtcgaaga acaaggtggc gcgtgcttcg       360
     ttgacgaact tcgtcgcgca gcggcccaac gaccggctcg cgttcatgat gttcggcacg       420
     agccccgtgc ttgcgatgcc gttcacctac gaccaccgtg cgatcgcggc ggcaattgcg       480
     ggcacggcgg tgggccgcgg catgccggac acgcaactcg accgtgggct gctggcggcg       540
     atcggcgagt tcaatggacg ggcctcctcg ggccgccggg cgatcgttct cgtctcggac       600
     ggcggcgcga gactcgacac acaggtacga cggctcattc aggatggact gacgcgcaac       660
     cagatcgcgc tttactttat ctacttgcgc agcggcacct acagtcccga cctgaacgcc       720
     gcggttcccg cgaatgagtc ttcggccgaa gccgaactgc atcgctactt tctctcgctg       780
     aagacaccgt accggctttt ccaggccggt aacgcgcgag cgatgaagga cgcaatggcg       840
     gagatcaacc ggcagcagaa cgcgcggact tcgtttgtcg agcgtctgcc gcgacaggat       900
     ctcagcccgt attgtttcgc cgtggcgctg tcggcgtgtg tgctcctgct gaccttgcgg       960
     ctgcttcagg tgcgggtctg gtcatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page