(data stored in ACNUC7421 zone)

EMBL: CP000271.PE606

CP000271.PE606       Location/Qualifiers
FT   CDS_pept        709496..710137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2417"
FT                   /product="Putative MxaK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33574"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR5"
FT                   /protein_id="ABE33574.1"
FT                   /translation="MKRTSIHVIFAAVALCCTGVAAYDWARLRHAQHVNQAVAAAAAET
FT                   GKAAAKSGAAGAPRNEHGERGNGNGNGNGNGNGNGNGNGDFREVRLARAIALSNAGAYD
FT                   AAGPLFEDLIRDDHLDEIGRAALFDLGNMYLRESLGNNPSGTVQSVAMIEEAKARYRTL
FT                   LRAAPDDWDARYNLERALWLAPETHASNDSPEVKSQHNVKVSDPQSKDLP"
     atgaagcgca catccattca tgtgattttc gcggctgtcg cactgtgctg caccggtgtc        60
     gcggcgtatg actgggctcg tctgcggcac gcgcaacacg tcaatcaggc ggtggccgca       120
     gcagcggctg aaacaggcaa agcggcggcc aaaagcggcg ccgcaggcgc cccgcgcaac       180
     gaacacggcg aacgcggcaa cggcaacggc aacggcaacg gcaacggcaa cggcaacggc       240
     aacggcaacg gcgacttccg cgaggtcaga ctcgcgcgtg ccatcgcgct gtcgaacgcc       300
     ggtgcctacg atgcggcagg tccactcttc gaggacctga ttcgagacga tcaccttgac       360
     gaaatcgggc gcgcggcgct gttcgatctc ggcaacatgt acctgcggga gagtttgggc       420
     aacaacccgt ccggcacagt gcagtcggtc gcgatgatcg aggaagcgaa ggcgcgctac       480
     cgcacgttgc tgcgtgcggc accggacgac tgggatgcac gctacaacct cgaacgggcg       540
     ctgtggcttg cgcctgaaac gcacgcctcg aacgattcgc ccgaggtcaa gtcgcagcac       600
     aacgtcaagg tcagtgatcc gcagagcaag gacctgccat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page