(data stored in ACNUC7421 zone)

EMBL: CP000271.PE607

CP000271.PE607       Location/Qualifiers
FT   CDS_pept        710134..711087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2416"
FT                   /product="Putative MxaL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33575"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR4"
FT                   /protein_id="ABE33575.1"
FT                   /translation="MSFREWTRGFSRGRHWATPAALLLLIAAVAMPRVVLPRNTFSYIV
FT                   TFDITQSMDVEDVALNGVPVSRLGFARSAMRDAIGRLPCGSKVGWSVFTGQRTLLLLPP
FT                   VEVCGNYDALLSSLDRIDWHMRWTNWSRIAEGGVYSAVRVAQDVGHGAAVVFVTDGQEA
FT                   PPVLPSDAPTRDINPARVTGWLIGVGGDQAAPIPHTDADGNRNGYWQADDVIQVPPQPG
FT                   SATQAESHEELSALHGHYLAAVAAQIGFGYRRLLGAEALSDAMLDVRFAHREPVPTDLR
FT                   WCPALLALLLLVWRFAPEFRWARGRVTGRSANSSYV"
     atgagcttcc gcgagtggac ccgtgggttt tcccgcggac gacactgggc gacacccgcg        60
     gcgctgctgt tgctgatcgc ggcggttgcc atgcctcgcg tggtgctgcc gcgcaatacg       120
     ttcagctata tcgtcacctt cgacattacg caaagcatgg acgtcgaaga cgtcgcgctg       180
     aatggtgtgc cggtgagccg gctggggttc gcgcggtcgg cgatgcgcga cgcgatcgga       240
     cgattgccgt gcggctcgaa ggtgggctgg agcgtgttca ccggtcagcg gaccttgctg       300
     ttgctgccgc ccgtcgaagt ctgcggcaac tatgacgcgc tgctttcgtc gctcgacagg       360
     atcgactggc acatgcgctg gaccaactgg agccgcattg ccgagggcgg cgtctattct       420
     gcggttcgcg tggcgcagga tgtcgggcat ggcgcggccg tggtgttcgt caccgatggc       480
     caggaggcgc cgccggtgct gccttcggat gcgccgacgc gggacatcaa ccctgctcgg       540
     gtgacggggt ggctgatcgg cgtcggcggc gatcaggccg cgcccattcc gcacaccgat       600
     gccgacggta atcgcaacgg ctactggcag gcagacgatg tgatccaggt tccaccgcag       660
     ccgggttccg caacgcaggc ggaaagccac gaggaactgt ccgcactgca cgggcattat       720
     cttgctgccg tggccgcaca gatcggcttc ggataccgcc gcctgttggg agccgaggcg       780
     ttgagcgatg ccatgctcga cgtgcgattc gcgcaccgcg aaccggtgcc gaccgacttg       840
     cgctggtgtc ccgcgctgct tgcgttgttg ctgctcgtct ggcgattcgc gccggagttc       900
     cgttgggcca ggggtcgtgt gaccggccga tccgcgaact cgtcatatgt gtaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page