(data stored in SCRATCH zone)

EMBL: CP000271.PE61

CP000271.PE61        Location/Qualifiers
FT   CDS_pept        complement(70176..70721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2966"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2966"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33029"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB0"
FT                   /protein_id="ABE33029.1"
FT                   /translation="MAKLLTDSEFQRFSELQQKQSSFTITPEEADELRDIVAHAQKRRD
FT                   DRAAAMQSIETFIQQFDISPDELFSAEQIGDAARTFGLIPAAKKERVLPPQFTFNGKPY
FT                   QWTTRPLPDDIRVPLFDAFKAGESVKSFIATPKDANRCAATIARLERETGAVYGDAWLE
FT                   ELSVTRTQVDEAAAKLPA"
     atggcgaaac ttctgaccga ttccgaattc cagcgttttt ccgaactcca gcagaagcag        60
     tcgagcttca cgatcacgcc tgaagaagcc gacgaactgc gcgacatcgt cgctcatgcg       120
     caaaagcgcc gtgatgatcg cgcggcggcg atgcaaagca ttgagacctt catccagcaa       180
     ttcgacatca gcccggacga gctgttttcc gccgagcaga tcggcgatgc cgctcgcacc       240
     ttcggtctga ttccggccgc gaagaaagaa cgcgtgctgc cgccgcaatt cacgttcaac       300
     ggcaaaccgt atcagtggac gacgcgcccg ctgccggacg atattcgcgt gcccttgttc       360
     gacgcgttca aggccggtga gtcggtcaag tcgttcatcg cgacgccgaa ggatgcgaac       420
     cgttgcgcgg cgaccattgc gcgcctcgaa cgcgagaccg gcgcggtgta tggcgacgcg       480
     tggcttgaag aactatcggt gacgcgtacg caagtcgacg aagccgctgc caagctgccg       540
     gcctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page