(data stored in ACNUC7421 zone)

EMBL: CP000271.PE612

CP000271.PE612       Location/Qualifiers
FT   CDS_pept        715695..716858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33580"
FT                   /db_xref="GOA:Q13QQ9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ9"
FT                   /protein_id="ABE33580.1"
FT                   /translation="MSTLSPASFADSPLSRALSQPLMLGLFLPIQSGGWSMSTLPRTTD
FT                   WSFDYNARLTRKAEALGFDLVFGLAQWLGKDGHGGTTRYRRDSLDSFITIASLASITNR
FT                   ILLISTLHILYGGWHPLHLAKFGATLDHISGGRWGLNMVTGHSVDEAEMFGREGHFEHD
FT                   LRYEMAGEFVDLMEQLWSLDDNLTFDGKWYRTRNAFVSPKPRFGRPVLVNATSSAAGID
FT                   YAAQHSDLIFITSSAGAQIDAALEVLPAHTAQVQARAQAHGRQVSTLINPTIVCRPTER
FT                   EAHAYHDAILSHADFGAVDGFTGRRSDAKAWKGHQREQRVLGGNIQIIGSPEHVVEDLL
FT                   RLKAAGIDGVQLTFFDFEPDLAYFGEAVLPLLEQAGLRVPLPTAAFF"
     atgtcgacct tgtctcccgc cagttttgcc gatagcccgc tttcgcgggc gctctcccag        60
     ccgctgatgc tgggcctgtt cctgccgatc cagagcggcg ggtggtccat gtcgacgctg       120
     ccgcgcacga ccgactggag cttcgactac aacgcgcggc tgacccgcaa ggctgaggct       180
     ctcggcttcg acctcgtgtt cggcctcgcg cagtggctcg gcaaggacgg ccatggcggg       240
     acgacccgct accgtcgcga ttcgctcgat tcgttcatca cgatcgcgtc gctggcttcc       300
     attacgaacc gcatcctgct gatctcgacg ctgcatattc tttacggcgg ctggcatccg       360
     ctgcatctcg cgaagttcgg cgcaacgctc gatcatattt ccggcggccg gtgggggctg       420
     aacatggtca cgggccattc ggtcgacgag gccgagatgt tcggccgcga aggccacttc       480
     gagcacgacc tgcgctacga gatggccggg gaattcgtcg acctgatgga gcagctctgg       540
     tcgctggacg acaacctgac gttcgacggc aagtggtatc gcacgcgcaa cgcattcgtt       600
     tcaccgaagc cgcgcttcgg ccggcccgtg ctggtcaacg caacgagttc ggcggccgga       660
     atcgactacg cggcgcaaca ctccgacctg attttcatca cgagctcggc gggcgcgcag       720
     atcgacgcgg cgctggaggt cttgccggcc cataccgcac aagttcaggc gcgtgcgcag       780
     gctcacgggc ggcaggtaag cacgctgatc aatccgacga tcgtctgccg gccgaccgag       840
     cgggaggcgc atgcctatca cgacgcgatc ctctcgcatg ccgattttgg cgcggtggat       900
     ggcttcacgg gccgccgcag cgacgcaaaa gcctggaagg gccaccaacg tgagcagcgg       960
     gtcctgggag gcaacatcca gatcatcggt tcacctgaac atgtggtgga agatctgctg      1020
     cgcctgaaag cagcgggtat cgacggcgtg caactgacct tcttcgattt cgagcccgat      1080
     ctcgcgtact tcggcgaagc cgtgctgccg ttgctggagc aggccggcct cagggtgccg      1140
     ctgccgaccg cggcattctt ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page