(data stored in ACNUC7421 zone)

EMBL: CP000271.PE613

CP000271.PE613       Location/Qualifiers
FT   CDS_pept        716913..718580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2410"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33581"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ8"
FT                   /protein_id="ABE33581.1"
FT                   /translation="MSHSTIPLITPAALRAALADRRELAILDVREEGVSARRRLFYSSI
FT                   AAVGRLGLVVGQLVPRLTTPVVLVDEAGEYASRAAALLASFGYTHVSILEGGVSGWEAA
FT                   GFEVFSGTNVPGKAFGEVIEHRLHTPNIDAPTLRQLQDAGEDLVVLDSRPFPEYQTMNI
FT                   PGGVECAGAELVHRALAAAPSPDTLIVVNCAGRTRSILGAQSLVNAGIPNPVAALTGGS
FT                   MSWLLSGFELERGRISTAPRPDGAALASARTLAQRAAARAGVVEIDRATLARFESEAAT
FT                   HTLYRFDVRAPLEYEAGHRAGWRSAPGGQLVQATDEYVGTLHARVVLADDDGVRARMTA
FT                   SWLVQLGYLQVFVLADDDSSAAFETGPEPLPIFRTRGRTQWIEADQLAQTLEAGSAQVV
FT                   DVDSSLAFRRAHIAGARFVAASALEDLLERIDADASRQLVLTSSDGVLAGLLANQLRER
FT                   REGVAALLGGTQRWLALGLPQASGDEGNLTGDDDAWYSPYHYAPAQAAQQMEAYLAWEL
FT                   QLVGQLERDGIASINVIDFDTPTHRRSEERLAALRRAN"
     atgagccact caaccattcc gctgattaca cccgccgcgt tgcgcgcagc gctcgccgac        60
     cggcgcgagc tcgccattct cgatgtccgc gaagaagggg tatccgcgcg ccgccggctg       120
     ttctattcgt ccattgcggc tgtcggtcgt cttggcctcg tcgtcgggca gctcgtgccc       180
     cgcctcacca cgccggtcgt gctggtcgat gaagcgggcg aatatgcgtc gcgtgccgcg       240
     gcactgctcg ccagcttcgg ctacacacac gtgtcgattc tcgaaggcgg cgtaagcggc       300
     tgggaagccg ccggcttcga ggtgttcagc gggaccaatg tgcctggcaa ggcgttcggc       360
     gaggtgatcg agcatcggct gcatacgccg aatatcgatg cgcctacgct caggcaactg       420
     caggacgcag gcgaggacct ggtggtgctc gatagtcggc cattccccga ataccagacc       480
     atgaacatac cgggcggtgt cgaatgcgcg ggtgccgagc tggttcaccg tgctctcgcg       540
     gccgcgccgt cgcccgatac gctgatcgtg gtcaattgcg cgggtcgcac gcgcagcatt       600
     ctcggtgcgc agtcgctcgt caatgccggt atcccgaatc ccgttgcagc gctcacggga       660
     ggatcaatgt catggctgct gtcgggattc gaactcgaac gcggccgcat cagcacggcg       720
     ccgcgtcccg acggagccgc gctcgccagc gcgcggacgc tcgcgcaacg cgcggcggcg       780
     cgagccggcg tggtcgagat cgaccgtgcc acgcttgccc gtttcgaaag cgaagcggcc       840
     acgcatacgc tttaccgttt cgacgtgcgc gctcctctgg aatacgaagc gggccatcgt       900
     gccggctggc gctcggcgcc cggcggacaa ctggtgcagg caaccgatga atacgtggga       960
     acgctccacg cacgcgtggt gctcgccgac gatgacggcg tgcgcgcgcg catgacggct      1020
     tcctggctcg tgcagctggg ttatctccag gtattcgtgc tggccgacga cgattcttcc      1080
     gcggcattcg aaaccggccc cgaaccgctg ccgatattcc gcacgcgagg ccgcacgcag      1140
     tggatcgaag cagaccagct tgcacagacg ctcgaagcgg gcagcgcgca ggtggtggac      1200
     gtggacagca gtctcgcgtt ccgccgcgcc catatcgccg gggcccgctt cgttgcggcg      1260
     agcgcgctcg aagatctgtt ggagcggatc gacgccgacg catcgcggca actcgtcctc      1320
     acttccagcg atggcgtact cgccggcctg ctggccaacc agttgcgtga acggcgcgaa      1380
     ggcgtggcgg cgctgctcgg cggtacgcag cgctggctgg cgctcggcct gccgcaggcc      1440
     agcggcgacg aaggcaacct gaccggcgac gacgacgcct ggtacagccc ttatcactac      1500
     gcgccggcgc aggccgcgca gcagatggag gcgtacctcg cgtgggagtt gcagctcgtc      1560
     gggcaactcg aacgcgacgg cattgcgtcg atcaatgtca tcgacttcga cacaccgacc      1620
     catcgccgca gcgaggaacg cctcgcggcg ctgcgtcgtg cgaactga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page