(data stored in ACNUC7421 zone)

EMBL: CP000271.PE614

CP000271.PE614       Location/Qualifiers
FT   CDS_pept        718620..719984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2409"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33582"
FT                   /db_xref="GOA:Q13QQ7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ7"
FT                   /protein_id="ABE33582.1"
FT                   /translation="MSAARTLHLNTNITGTGRHPAGWRTLDNPKSIIDLGFFTTIAQIA
FT                   ERGKLDAVFLSDAVALRGHAHGPAQSLEPTVLLTALAGVTRHVGLIGTASTTFNDPFNL
FT                   ARRFASVDHLSAGRVAWNAVTTYDPEAAANFSIAESPDKQARYARAEEFVEVVLKLWDS
FT                   WEDNALIADRASGRYADPARVHAIAHAGRHFQVRGPLNLPRSPQGRPVLVQAGGSEAGV
FT                   ALAARHADAVFTAQTTFEGAQDFYRDIKARAVAHGRHPDHLLVLPGLYPVIGGTLAEAR
FT                   RRKADMDALLDRGAELAKFAGALGIDAAALQLDAPLPYDLIDKGDRTDVSRGFIRSTVL
FT                   LARGENLTVRDLLDRNPGAHRMIVGTPETIADDIERWFAGRAADGFNLNADVFPSGLAD
FT                   FVDHVVPLLQRKGIFRREYEGTTLRDHYGLARPSSRYADAATSAVADADALGAVS"
     atgagtgcgg cacggacact gcatctgaat accaacatca ccggcacggg acgtcatccg        60
     gccggctggc ggacgctcga caatccgaag tcgatcatcg acctcgggtt cttcaccacc       120
     atcgcgcaga tcgccgagcg cggcaagctc gacgcggtgt ttctctccga cgcggtggcg       180
     ttgcgcggcc acgcacacgg gccggcgcag tcgcttgaac cgacggtgct gcttaccgcg       240
     cttgccggcg tgacgcgaca tgtcgggctg atcggcaccg catcgaccac cttcaacgat       300
     ccgttcaatc tggcgcgccg cttcgcgtcg gtggatcacc tgagcgccgg gcgggtcgcg       360
     tggaatgccg tgacgaccta cgacccggaa gcggccgcca atttcagcat tgcagagtcg       420
     cccgacaagc aggcgcgtta cgcgcgcgcc gaggagttcg tcgaagtcgt gctgaagctg       480
     tgggatagct gggaagacaa tgcgctgatc gccgatcgcg caagcggacg ctatgccgac       540
     ccggcgcgcg tgcatgccat cgcgcatgcc ggccgtcatt ttcaggtgcg cgggccgctg       600
     aacctgccac gcagtccgca agggcggccg gtgctggtgc aggcgggcgg ctcggaggcg       660
     ggtgttgcgc tggccgcgcg ccatgcggat gcggtgttca cggcgcagac cacgttcgaa       720
     ggcgcacagg atttctatcg ggacatcaag gcgcgtgccg tcgcgcatgg acgccacccc       780
     gatcatctgc tggtgctgcc gggcctttac ccggtgatcg gcggcactct tgccgaggcg       840
     cgccggcgta aagccgacat ggatgcgctt ctcgaccgcg gggccgagct cgccaaattc       900
     gctggtgctc tcggtatcga cgccgccgct ctgcaactgg atgcgccgtt gccttatgac       960
     ctgatcgaca agggcgatcg taccgacgtg tcgcgcggat tcatccgctc cacggtgctg      1020
     ctggcccgag gcgagaacct gacggttcgc gatctgctcg accgcaatcc cggcgcacac      1080
     cggatgatcg tgggcacacc cgagaccatt gcggacgaca tcgaacgctg gttcgccggt      1140
     cgcgccgcgg acggcttcaa cctcaacgcc gacgtcttcc cttcagggct cgcggacttc      1200
     gtcgatcacg tcgtgccgct gctgcagcgc aaaggcattt tccgccgcga gtacgagggt      1260
     acgacgttac gcgaccacta tggtctcgcg cgaccgtcca gccgctatgc cgatgccgcg      1320
     acgagtgccg tggcggatgc ggacgcgctc ggtgcggtct cctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page