(data stored in ACNUC7421 zone)

EMBL: CP000271.PE615

CP000271.PE615       Location/Qualifiers
FT   CDS_pept        720048..720875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2408"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33583"
FT                   /db_xref="GOA:Q13QQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ6"
FT                   /protein_id="ABE33583.1"
FT                   /translation="MSTRESTFTAAPAPAPAATASRLATLREPLLRAAIPVLLIALWQL
FT                   ASTLGVVSEFVLPAPASVLTAYRELWQSGDLQDALKISLARAALGLLIGGGAGLLLGVA
FT                   AGLSKSAERGFDTVLQMLRTIPFIALVPIFVVWFGIGELSKVALIVGAAISPMYLSTYH
FT                   AIRGIDPKLLELGRTFRLTRGHQIRLIILPTALPGILVGVRYSAAISLLALVAAEQINA
FT                   SAGIGFILNNANQFQRTDIIIAGILVYAALGIAVDALLRFIERKALVWRGAHV"
     atgtctacga gagaatccac ttttaccgcg gctcccgcac cggctccagc cgcgacagcc        60
     tcgcggctgg cgacgctgcg cgagccgctg ttgcgggccg cgatcccggt gctgttgatc       120
     gcgctctggc agttggcctc gacactcggt gtggtcagcg agttcgtgct gccggcgccg       180
     gcatcggtgc tgacggccta tcgggagttg tggcagtccg gcgatctgca ggatgcgctg       240
     aagatatcgc tggcgcgtgc ggcattgggg ctgctgatcg gcggcggcgc ggggttgctg       300
     ctgggcgtgg cggcgggtct gagcaagtcc gctgaacgcg gtttcgacac ggtgctgcag       360
     atgctgcgga ccataccgtt cattgcgctg gtgccgatct tcgtcgtctg gttcggaatc       420
     ggcgaactgt ccaaagtcgc gttgatcgtc ggcgcggcga tttcgcccat gtatctcagc       480
     acgtaccacg ccatacgcgg catcgacccg aagctgctgg aactcggccg cacgttccgc       540
     ctgacgcgcg ggcatcagat acggctcatc attctgccga ccgcgctgcc cggcatactc       600
     gtcggcgttc gctattccgc agccatctcg ctgctcgcgc tcgtggcggc ggagcagatc       660
     aatgcaagcg ccggcatcgg cttcattctg aacaacgcca accagttcca gcgcaccgat       720
     atcatcatcg ccggcattct cgtctatgcg gcgctcggca ttgcggtgga cgcgctgctg       780
     cgtttcatcg aacgcaaggc cctcgtctgg agaggtgcgc atgtctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page