(data stored in ACNUC7421 zone)

EMBL: CP000271.PE616

CP000271.PE616       Location/Qualifiers
FT   CDS_pept        720868..721605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2407"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33584"
FT                   /db_xref="GOA:Q13QQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ5"
FT                   /protein_id="ABE33584.1"
FT                   /translation="MSELAYQPDYDAAPVVARLSGARKRYGENTVLDNVDFTVRKGECV
FT                   ALVGPSGTGKTTLLRLLAGLESVSGGRTEVTQNTSVVFQEPRLIQALRVWKNVLLDDAH
FT                   KPDAKARARVALQDVGLEDKLESWPVSLSGGQAQRVAVARALYRSPELMLLDEPFSALD
FT                   AFTRRSMQSLVLKLWAKYRFGLVIVTHDLDEALILADRIVILSKGRICHETQVDLPRER
FT                   DVTSPEFNALKRDLLKQFSLSLS"
     atgtctgagc tcgcctatca gcctgactac gacgcagcgc cggttgtcgc aagactgtcc        60
     ggcgccagga agcgctacgg cgaaaacacg gtgctcgaca acgtggactt cacggtccgc       120
     aagggcgagt gtgtcgcgct ggtcggcccg tcgggtacgg gcaaaaccac gctgttgcgc       180
     ttgctggccg gcctcgaatc cgtttcgggc ggcaggaccg aggtgacgca gaacacctcc       240
     gtcgtcttcc aggagccgcg gctgatacag gcgttgcgcg tgtggaaaaa cgtgctgctg       300
     gacgacgcgc ataagcctga tgcaaaagcg cgcgcccgtg tcgcgctgca ggacgtcggg       360
     ctcgaagaca agctggagag ctggcccgtc agcctctcgg gcggccaggc gcagcgtgtt       420
     gccgtggctc gggcgctcta tcgcagcccc gaactcatgc tgctggacga gccgttcagc       480
     gcgctggacg cgttcacccg ccgcagcatg cagagcctgg tcctgaagct gtgggccaaa       540
     taccggttcg gtctcgtcat cgtgacgcat gacctggacg aggcgctgat tcttgccgac       600
     cgcatcgtga ttctctccaa aggccggatc tgccacgaaa cgcaagtcga tctgccacgc       660
     gaacgcgacg tgacctcgcc cgaattcaac gcactcaagc gcgacttgct caaacagttt       720
     tcgctcagtc tgtcctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page