(data stored in ACNUC7421 zone)

EMBL: CP000271.PE617

CP000271.PE617       Location/Qualifiers
FT   CDS_pept        721636..722682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2406"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33585"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ4"
FT                   /protein_id="ABE33585.1"
FT                   /translation="MSLKKSLFAGMAVFLAAATLTLSGTAAAQTTPDLKGTKLVIAYQD
FT                   PAFPALIRKSGVVNGTPYQIEWVLLTGPAANLSALYANRIDLGHMGDTSLTIEQANART
FT                   EWTKESTPLRIVAGWRNFYSKDYPPVVTAVRTSAGINTVQEIKGHKVGYNYGGYNHSQY
FT                   LATLVKAGLTEKDIQPIKFADGATSAAGFNAGEVDVYAGALGPILPTIKSGAGRILLLD
FT                   RDTQIPALNVWTTTSTVLKDPTKVAALRDYFSRLSGYWQWHDTHKDEVIGVLKDTLKVS
FT                   DERAAFEYEVRSGSFVKFDSGLIGQEQKIADILYDGHAIRKKVDVAVEYDPQFNAVQKA
FT                   VWPIKVKN"
     atgtcgctga agaaatcatt attcgctggc atggctgtct ttcttgccgc tgccacgctg        60
     actttgtccg gtacggccgc agcccagacc acgcccgacc tgaagggcac gaagctcgtc       120
     attgcatatc aggatccggc ctttcccgcg ttgatccgca aatcgggcgt ggtcaacggg       180
     acgccttacc agatcgaatg ggtgctgctg acagggccgg ccgccaacct gtcggcgctg       240
     tacgccaacc ggatcgatct gggccatatg ggcgatacgt cgctcacgat cgaacaggcc       300
     aacgcgcgca cggaatggac gaaagagtcg acaccgctgc gtattgtcgc gggctggcgc       360
     aatttctatt cgaaggacta tccgccggtt gtcaccgcag tgcggacaag tgccgggatc       420
     aataccgtgc aggagatcaa aggacacaag gtcggctata actacggcgg ctacaaccat       480
     tcgcaatacc tggccacgct ggttaaagcc gggttgaccg agaaagacat tcagcccatc       540
     aagttcgccg atggcgcgac ttcggccgcc ggcttcaacg ccggcgaggt ggacgtgtac       600
     gccggcgccc tcggcccgat attgcccacg atcaagtcgg gcgccggccg tatcctgctg       660
     ttagaccgcg acacccagat tccggcgctg aacgtatgga cgacgacgtc cacggtgttg       720
     aaagacccga ccaaggtcgc cgcgctgcgg gattacttct cgcgactgtc gggctactgg       780
     caatggcatg acacgcataa ggacgaggtg atcggcgttc tcaaggacac gctcaaggtg       840
     tccgacgaac gggccgcgtt cgagtatgaa gttcgcagcg gcagtttcgt caagttcgat       900
     tccgggctga tcggccagga acagaaaatc gccgacattc tgtacgacgg gcacgcgatc       960
     cggaagaagg tggacgttgc tgtcgaatac gatccgcaat tcaatgcggt gcaaaaagcc      1020
     gtctggccga tcaaggtcaa aaactga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page