(data stored in ACNUC7421 zone)

EMBL: CP000271.PE618

CP000271.PE618       Location/Qualifiers
FT   CDS_pept        722776..724392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2405"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33586"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ3"
FT                   /protein_id="ABE33586.1"
FT                   /translation="MDVRKMPKGIDAATLKRWLHDGSEIALFDVREHGQYGEGHPFYAV
FT                   PLPYSVLERDVGRLAPNRRVRVVVYDSGDGDDGPAARAAARLETLGYASVHVLEGGTRA
FT                   WQDAGFVLFKGVNVPSKAFGELVEQVAHTPHISAQTLLQWQQSDTPPVVLDGRPLGEYR
FT                   TMNIPGASCCPNGELAYRIDAFVPDAQTPIVINCAGRTRSIIGAQTLLDLGIRNPVYAL
FT                   ENGTQGWFLADLPLERGQQRGYPADLRPQPARVAAARALAERAGVEWVHADTVRDWTKA
FT                   DDRTLYLCDVRTPEEFAANTLPGAQHAPGGQLQQATDQYIGVRNARIVLFDDDGIRAPV
FT                   TASWLRQLGHEAWVLEGGLHSGLALADTRIPEPAALPLVDGDTLAQRLAAGSQSVVDLR
FT                   TSAAWLAAHIPGSVWSIRPRLAATLAQCEQAVTFVVDDPRIAAWAVSDLAGGEGHTFSV
FT                   LDGGFAAWPAGGWRVETDAVADVLPPSARIDYLFFTHDRHAGNKAASREYLSWELGLLG
FT                   QLDELERSAFRPLTRVVAAPE"
     atggatgtca ggaaaatgcc aaagggaatc gacgcggcca cgctgaagcg ctggctgcac        60
     gacggcagcg aaatcgcact gttcgacgtg cgcgagcacg ggcaatacgg cgagggtcac       120
     ccgttctacg cggtgccgct gccgtatagc gtgctggagc gcgacgtcgg acgtctcgcg       180
     ccgaaccggc gcgtgcgggt ggtcgtgtac gacagcggtg acggcgacga cggccccgcg       240
     gcgcgggctg ctgcacggct ggagacgctg ggttatgcct cggttcacgt gctcgaaggc       300
     ggcacgcgtg cgtggcaaga tgcgggcttc gtcctgttca agggtgtgaa cgtgccctcc       360
     aaggcgttcg gcgaactggt cgagcaggtc gcgcacacgc cgcatatatc ggcgcagacg       420
     ctgttgcagt ggcagcagtc ggatacgccg cctgtggtgc tcgatgggcg cccgctgggc       480
     gagtaccgca cgatgaacat tcccggcgcg tcgtgttgcc cgaacggcga acttgcctac       540
     cgcatcgacg cgttcgtgcc ggatgcgcag acgccgatcg tcatcaactg tgcagggcgg       600
     acgcgcagca tcattggcgc gcagacgctt cttgatctcg gcattcgcaa cccggtgtac       660
     gcgctcgaaa acggaacgca gggctggttc cttgcggatc tgccgctcga acgaggccag       720
     cagcgcggct atccggccga cctgcggccg caaccggcgc gcgtcgctgc cgcgcgtgcg       780
     ttggcggagc gcgcgggcgt ggaatgggtt catgcggata ccgttcgcga ctggacgaag       840
     gcggacgatc gcacgctgta tctgtgcgat gtccggacac cggaagagtt cgcggcgaac       900
     actttgcccg gcgcgcagca tgcgccgggt ggccagctac agcaggcgac cgatcaatac       960
     atcggtgtgc gcaacgcacg catcgtgctg ttcgacgacg acggtatccg agcgccagtc      1020
     accgccagct ggctgcgtca gttgggacac gaagcgtggg tgctggaagg cgggctgcac      1080
     agcggactcg cgctggccga cacgcggatc cccgaacccg cggcgcttcc cttggtcgat      1140
     ggggatactc tcgcgcagcg ccttgcggca ggcagtcaat ccgtcgtcga tctgcgtacg      1200
     agcgcggcgt ggctggccgc gcatattccc ggtagcgtct ggtcgattcg cccgcgtctt      1260
     gcggccacgc tcgcgcaatg cgagcaggcc gtgacgttcg tagtggacga tccgcgtatc      1320
     gccgcttggg ccgtgagtga tctcgccggt ggtgaagggc acacgtttag cgtgctcgat      1380
     ggtggcttcg ccgcttggcc ggcgggtggc tggcgtgtgg aaacggatgc ggttgcggac      1440
     gtattgccgc cgtccgcgcg tatcgactat ctgttcttca ctcacgaccg gcacgcgggc      1500
     aacaaggcgg cgtcccgcga atatctttct tgggagctgg gcttgctcgg acaactcgat      1560
     gagcttgagc gtagcgcgtt ccgtccattg actcgggtgg ttgccgcgcc ggaataa         1617
//

If you have problems or comments...

PBIL Back to PBIL home page