(data stored in ACNUC7421 zone)

EMBL: CP000271.PE620

CP000271.PE620       Location/Qualifiers
FT   CDS_pept        725139..725828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33588"
FT                   /db_xref="GOA:Q13QQ1"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ1"
FT                   /protein_id="ABE33588.1"
FT                   /translation="MAKVMVVGQGRPAKRKVDPWFPEIRSHYLASFLNRGEFNRMRDVI
FT                   RAFVATRVPNRRRLEARLFESGIMMRAINLFFLLFFTCTAVYSSESIYGSAFDYKKAKP
FT                   ANIYFSGKTQAEIKIYCEKVASATIDLSVCAQFRFEGVAQELDRKFREIEKEIVIGDKD
FT                   RRAIGEPEATPYLKKAQANWKRYRDNQCYARTYEVGQASLRFVEFWDCMARVTRNRLNE
FT                   LTTANEE"
     gtggctaaag tcatggtagt gggacagggc cgtccagcca aacggaaagt cgatccgtgg        60
     tttccagaaa tccgctcgca ttatctggca agttttttaa acagagggga gttcaataga       120
     atgcgcgacg tgatccgggc atttgtcgcg acccgtgtgc caaaccgccg ccgcctggag       180
     gcgcgacttt tcgagtccgg aattatgatg cgagccatta atctattctt cctgcttttc       240
     tttacttgta ctgcggtata ttcatcggaa tcaatctatg gttcggcgtt cgactacaag       300
     aaggcaaaac ctgcaaatat ctatttttcc gggaaaacac aagcagaaat aaaaatatat       360
     tgcgaaaaag tcgccagcgc gacgatagat ttatcggtat gtgctcaatt cagatttgaa       420
     ggggtggccc aagagctcga taggaaattc agagaaattg aaaaggaaat cgtaattggc       480
     gacaaggacc gccgtgccat cggggagccg gaagcaaccc cttacttgaa aaaagcccag       540
     gcaaactgga agcggtacag agacaatcaa tgctacgcca ggacatacga agtcggtcag       600
     gcatcccttc ggtttgtgga attttgggat tgtatggccc gggtcacccg aaacaggctt       660
     aacgaattga caacggctaa tgaagaatag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page