(data stored in ACNUC7421 zone)

EMBL: CP000271.PE621

CP000271.PE621       Location/Qualifiers
FT   CDS_pept        725973..726230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33589"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ0"
FT                   /protein_id="ABE33589.1"
FT                   /translation="MRREICSRTGVMIRVIKAIISAIGFVFATAVFADVACEKHEKTCD
FT                   DFLKCSQIDADKILSDSKKLYLKVREFAKGDKRAALDRNY"
     gtgcggaggg aaatatgttc aaggacggga gttatgattc gagtcattaa agcaatcatt        60
     tcggcaattg gttttgtgtt tgcaacggct gtatttgcgg atgtggcatg tgagaaacat       120
     gaaaaaacgt gtgatgattt tctcaagtgc tcacaaattg atgctgacaa gatactttcc       180
     gactcgaaaa agctatatct gaaggtcagg gagttcgcca aaggagataa gcgtgctgca       240
     ttagatagaa attattaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page