(data stored in ACNUC7421 zone)

EMBL: CP000271.PE622

CP000271.PE622       Location/Qualifiers
FT   CDS_pept        726466..726768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33590"
FT                   /db_xref="GOA:Q13QP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP9"
FT                   /protein_id="ABE33590.1"
FT                   /translation="MTRRFSLIAFLLAFLYEASVEAVLLWSLPLKPTGWGAIIASLTTN
FT                   PLAFVYAMKRRKWAFDLLKWIAAFSIVWTVSGFVRKETAKYNPLAILYLLSLIRE"
     atgacccgcc gcttttcact tatcgcgttt cttctggcct ttctgtatga ggcatcagtg        60
     gaagcggttt tgttatggag cctgccttta aagccaacag gttggggcgc aataatcgcg       120
     agcctcacaa ccaatccgct cgcgtttgtc tacgcaatga agcgcagaaa atgggccttc       180
     gatcttctca agtggatcgc cgcgtttagc attgtgtgga ctgtatcggg cttcgtgcgg       240
     aaggaaaccg ccaaatataa cccgctcgcc atcttgtatt tactctcact catccgcgaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page