(data stored in ACNUC7421 zone)

EMBL: CP000271.PE624

CP000271.PE624       Location/Qualifiers
FT   CDS_pept        complement(728259..728681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33592"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP7"
FT                   /protein_id="ABE33592.1"
FT                   /translation="MEFDSDWLTLGRHRVRLRSPRGFPTEGMRTAVDVMRLAIENNMSA
FT                   RARLVDVAVREEKSYDVSVGTTFAEDRLCVPQLEAAIAVVLGLLPGQIRIFVTVVTQEE
FT                   VDLHFGVYERMLAEKIGGLAPISQAYSANASNASDG"
     atggaattcg attctgactg gctcacgctc ggcaggcatc gcgttcgtct gcgctcgccg        60
     aggggctttc ctaccgaggg catgcgcaca gcggtggacg tgatgcgcct cgccatcgaa       120
     aacaatatga gcgcccgcgc ccgtctcgtg gatgtggcgg tgcgtgaaga aaaatcgtat       180
     gacgtctcgg ttggcacgac gttcgccgaa gaccggttgt gcgtccctca actcgaggcg       240
     gcgatcgcag tcgtgctcgg cctgttgcct gggcagatcc gcatctttgt gacggtggtg       300
     acgcaggagg aggtcgatct gcatttcggc gtgtacgaga gaatgctcgc ggaaaaaatc       360
     ggcggactcg cgcccatttc gcaggcgtac tcggccaacg caagcaacgc gtcggacgga       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page