(data stored in ACNUC7421 zone)

EMBL: CP000271.PE625

CP000271.PE625       Location/Qualifiers
FT   CDS_pept        728934..729377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2398"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33593"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP6"
FT                   /protein_id="ABE33593.1"
FT                   /translation="MSDLYFTTDLFSQFDRLHQQMATLFGGYPSSIRSDRLSAFPQINI
FT                   GTTDDTIDIVAFAPGIDPKQLEVSIDKGLLTIAGERAAVTPDASDEAARHYARERFSGA
FT                   FRRVIELPQHADPDKVEARYVNGCLCITVGKRESSRPRAITVQ"
     atgagtgatc tctacttcac gaccgacctg ttcagccagt tcgatcgtct gcaccagcag        60
     atggcaacgc tgttcggcgg ctatccttcc agcatccgtt cggaccgcct gtcggcgttt       120
     ccgcaaatca acatcggcac gaccgacgac actatcgaca tagtcgcgtt cgctccgggc       180
     atcgatccga agcaactgga ggtgtcgatc gacaagggcc tcctcaccat cgccggcgaa       240
     cgcgctgccg tgacgcccga tgcgtcggac gaggcggcac gccattacgc gcgggaacgc       300
     ttcagcggtg catttcgccg cgtcatcgag ttgccgcagc acgccgatcc cgacaaggtc       360
     gaggcccgct atgtgaacgg ttgcctctgc atcacggtcg gcaagcgcga gtcttcccga       420
     ccccgcgcga tcaccgtgca gtaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page