(data stored in ACNUC7421 zone)

EMBL: CP000271.PE626

CP000271.PE626       Location/Qualifiers
FT   CDS_pept        729403..729810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2397"
FT                   /product="Putative heat shock Hsp20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33594"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP5"
FT                   /protein_id="ABE33594.1"
FT                   /translation="MNDTTQLARRDSNTVSRAEPERTEQRVTLSPAVDVIENAHGVTLW
FT                   ADLPGVPRENLEIRVQDGNLRIEASANIPTREGLRLQHAEVRVPHFARSFTLGPEFDTS
FT                   KIEAKLQDGVLKLSIPRREEARPRRIEVAVG"
     atgaacgaca ctacgcaact cgctcgccgt gactcgaaca ccgtcagtcg cgcggagcct        60
     gaacgaacgg aacagcgcgt gacgctcagt ccggcagtcg acgtgatcga aaacgcgcac       120
     ggcgtgacgc tgtgggccga tctgcccggc gtgcccagag agaatctcga gatcagggtg       180
     caggacggca atctgcgtat cgaggcatct gccaacatcc cgacacggga agggctgcgt       240
     ctgcaacacg cggaggttcg tgtgccgcat tttgcgcggt cgtttacgct cggaccggag       300
     ttcgatacgt cgaagatcga ggcgaagctc caggatggcg tgctgaagct gtcgattcca       360
     cggcgcgaag aggcgcggcc gcgacgcatc gaggtggccg tcggctaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page